KEGG   Actinoplanes sp. N902-109: L083_6284Help
Entry
L083_6284         CDS       T02655                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00230  Purine metabolism
actn00250  Alanine, aspartate and glutamate metabolism
actn01100  Metabolic pathways
Module
actn_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    L083_6284
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L083_6284
Enzymes [BR:actn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     L083_6284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGL19794
UniProt: R4LVU2
Position
complement(7195507..7196700)
Genome map
AA seq 397 aa AA seqDB search
MSAGHVAVVDLGYGDAGKGRVVDTLCGTGPVRAVLRFNGGAQAAHNVVAPDGRHHTFAQF
GSGTFHGVPTHLTRFVVVDPLALAAEAAALGNPFHLLTVDADALLVTPWHRAANRVRERQ
RGAARHGSCGMGIGQAMEYSLGHADAPRAGSFTRASLAAVRDRLTAAYGPLDAPPLDDVY
EAFTAFARTVSIVDSGYTRRLLREGRCVFEGAQGVLLDEWRGFHPYTTWSTTTFDNVAEL
CDSFQRLGVVRTYTTRHGAGPLVTEAPLALPEPHNGRGEWQGAFRVGHFDAVAHRYAVAV
AGGVDALAITHLDAPGRCPDLRICTSYDTTDRLTPGPFRDLAHQSALTGLLMAARPGRLH
RPESFAADISDLLGAPVALESWGATGTCRSGELSSAR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgggcacgtcgccgtggtcgacctcggctacggcgacgccggcaagggccgg
gtcgtggacacgttgtgcggcaccggcccggtgcgcgcggtcctgcgcttcaacggggga
gcgcaggccgcccacaacgtcgtcgccccggacggccggcaccacaccttcgcgcagttc
gggtcgggcacgttccacggcgtgcccacccacctgacccggttcgtggtggtcgacccg
ctggcactggccgccgaggcggctgccctgggcaacccgttccacctgctgaccgtcgac
gcggacgcgctgctggtcacgccgtggcaccgggcggccaaccgggtgcgcgagcggcag
cgcggtgcggcccggcacggctcgtgcggcatgggcatcgggcaggccatggaatactcc
ctcggccacgccgacgccccgcgggcgggatcgttcacccgcgcttcgctcgccgccgta
cgggaccggctgaccgccgcgtacggcccgctggacgccccaccgctggacgacgtgtac
gaggcgttcacggccttcgcgcggaccgtctccatcgtggacagcggctacacccgacgg
ttgctccgcgaggggcgatgcgtgttcgagggtgcgcagggggtgctgctcgacgagtgg
cgcggcttccacccgtacaccacctggtccaccacgacgttcgacaacgtggccgagctg
tgcgactcgttccagcggctcggggtggtgcgcacgtacaccacccggcacggcgccggc
ccgctcgtcaccgaggccccgctggcactgcccgaaccgcacaacgggcggggggagtgg
cagggcgcgttccgggtgggccacttcgacgcggtcgcgcaccgctacgccgtggcggtg
gccgggggcgtcgacgcgctggcgatcacccacctggacgcccccgggcggtgcccggac
ctgcgcatctgcacgtcgtacgacacgaccgaccggctgaccccgggaccgttccgcgac
ctggcgcaccagtcggcactgaccggcctgctcatggccgcccggcccggccggctgcac
cgccccgagtcgttcgccgcggacatcagcgacctgctcggcgccccggtggcgctggag
tcgtggggcgctacaggtacatgccggtcgggggagctgtcgtcggcacggtga

DBGET integrated database retrieval system