KEGG   Actinoplanes sp. N902-109: L083_6588Help
Entry
L083_6588         CDS       T02655                                 

Gene name
ltaA
Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00260  Glycine, serine and threonine metabolism
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
actn01120  Microbial metabolism in diverse environments
actn01130  Biosynthesis of antibiotics
actn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    L083_6588 (ltaA)
Enzymes [BR:actn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     L083_6588 (ltaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AGL20098
UniProt: R4LNR0
Position
complement(7543042..7544109)
Genome map
AA seq 355 aa AA seqDB search
MNQLHDSTTRTFASDNYAGAHPEVLAALATANGGHQISYGADVYTERLAEVIRGHFGAQA
EVHPVFNGTGANVTALTSLLPRWGAVVTAATAHINTDENGAPERISGLKLLPVATPDGKL
TPELIDREAWGWGDEHRAQPLAVSITQTTELGTLYTPAEIRAIADHIHAKGMTLHMDGAR
IANAAAALGLPLRAFTTDAGVDILSFGGTKNGLLYGEAIVTLTPGTATGLTYLRKLNMQL
ASKMRFVSAQFLALFEDDLYLRSAAHANAMAARLRTALEQSIATGELTGLTFTRPTQANA
VFAALPAEAADRIRRSVRFYDWDRATGEVRWMTAFDTTPEDVDAFVTIIKKELTA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagctgcatgacagcacgacccggacctttgccagcgacaactacgccggggcg
caccccgaggtcctcgcggccctggccacggccaacggcggccaccagatctcgtacggc
gcggacgtctacaccgagcgcctcgccgaggtcatccgcgggcacttcggcgcgcaggcc
gaggtccacccggtcttcaacggcaccggcgcgaacgtcaccgcgctgaccagcctgctg
ccccgctggggagcggtcgtcaccgcggccaccgcccacatcaacaccgacgagaacggt
gctcccgagcgcatcagcggcctcaagctgctgccggtcgccacccccgacggcaagctg
acccccgagctgatcgatcgggaggcctggggctggggcgacgagcaccgggcccagccg
ctggccgtcagcatcacccagaccaccgaactgggcacgctctacaccccggccgagatc
cgcgccatcgccgaccacatccacgccaagggcatgaccctgcacatggacggcgcccgc
atcgccaacgccgccgcggcgctcggccttccgctccgcgccttcaccaccgacgccggc
gtcgacatcctcagcttcggaggaaccaagaacggcctgctgtacggcgaagcaatcgtc
accctgactccgggtacggcaaccgggctgacctatctgcgcaaactgaacatgcaactg
gcgtccaagatgcgcttcgtcagcgcccagttcctcgccctcttcgaggacgacctgtat
ctgcgctcagccgcccatgccaacgccatggcagcccgcctgcgcaccgccctcgaacaa
tcgatcgccaccggcgaactcaccggcctcaccttcacccggcccacccaggccaacgcc
gtcttcgccgccctccccgccgaagccgccgaccgcatccgccggtccgtccgcttctac
gactgggacagggccaccggcgaggtccgctggatgaccgccttcgacaccacccccgag
gacgtcgacgccttcgtcaccatcatcaagaaggagctcaccgcttag

DBGET integrated database retrieval system