KEGG   Actinoplanes sp. N902-109: L083_7506Help
Entry
L083_7506         CDS       T02655                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
actn  Actinoplanes sp. N902-109
Pathway
actn00010  Glycolysis / Gluconeogenesis
actn00053  Ascorbate and aldarate metabolism
actn00071  Fatty acid degradation
actn00280  Valine, leucine and isoleucine degradation
actn00310  Lysine degradation
actn00330  Arginine and proline metabolism
actn00340  Histidine metabolism
actn00380  Tryptophan metabolism
actn00410  beta-Alanine metabolism
actn00561  Glycerolipid metabolism
actn00620  Pyruvate metabolism
actn00625  Chloroalkane and chloroalkene degradation
actn00903  Limonene and pinene degradation
actn01100  Metabolic pathways
actn01110  Biosynthesis of secondary metabolites
actn01120  Microbial metabolism in diverse environments
actn01130  Biosynthesis of antibiotics
Module
actn_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:actn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    L083_7506
   00053 Ascorbate and aldarate metabolism
    L083_7506
   00620 Pyruvate metabolism
    L083_7506
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L083_7506
   00561 Glycerolipid metabolism
    L083_7506
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L083_7506
   00310 Lysine degradation
    L083_7506
   00330 Arginine and proline metabolism
    L083_7506
   00340 Histidine metabolism
    L083_7506
   00380 Tryptophan metabolism
    L083_7506
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    L083_7506
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    L083_7506
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    L083_7506
Enzymes [BR:actn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     L083_7506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGL21016
UniProt: R4LVP8
Position
8496043..8497461
Genome map
AA seq 472 aa AA seqDB search
MFEYAPAPESRSVVDIAPSYGVFIDGRFTEGSGSFKTVNPASEEVLSEVSLAGPEDVDRA
VAAARRAYESWSNLPGSERAKYLFRIARIIQERSRELAVLESLDNGKPIRESRDVDLPLV
AAHFFYYAGWADKLKYAGFGPDPRPLGVAAQVIPWNFPLLMLAWKVAPALATGNTVVLKP
AETTPLSALFFADICRQAELPPGVVNIITGAGDTGRTLVEHPGVDKVAFTGSTEVGRQIA
RSVAGTSKRLTLELGGKAANIVFDDAPIDQAVEGIVNGIFFNQGHVCCAGSRLLVQESVY
DEVLEALKRRMATLRLGDPLDKNTDIGAINSAEQLERIRRLTEAGAEEGAERWSAPCELP
AQGFWFAPTIFTGVTQAHRIAREEIFGPVLSVLTFRTPAEAIEKANNTPYGLSAGLWSDK
GSLILAVADKLRAGVVWANTFNKFDPTSPFGGYKESGYGREGGRHGLEAYLA
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatacgcccccgcccccgagtcccgctcggtcgtcgacatcgcgccgtcctac
ggcgtgttcatcgacggccggttcaccgaaggctccggctcgttcaagacggtcaacccc
gcgtcggaggaagtgctctccgaggtgagcctggccggcccggaggatgtcgaccgcgct
gtggcggctgcccgccgggcgtacgagtcatggtcgaatctgcccggcagtgagcgcgcc
aagtatctgttccggatcgcccggatcatccaggagcggtcccgcgagctggccgtgctg
gagtcgctcgacaacggcaagccgatccgcgagtcccgcgacgtcgacctgccgctggtc
gccgcgcacttcttctactacgcgggctgggccgacaagctgaagtacgccggtttcggc
cccgacccgcgaccgctcggcgtcgccgcccaggtcatcccgtggaacttcccgctgctc
atgctcgcgtggaaagtcgccccagcgctggccaccggcaacacggtcgtcctcaagccg
gccgagacgaccccgctgtccgcgctgttcttcgccgacatctgccgccaggccgagctg
ccgccgggcgtcgtcaacatcatcacgggcgcgggcgacaccggccgcacgctcgtcgag
caccccggcgtcgacaaggtcgcgttcaccggctccaccgaggtcggccggcagatcgcc
cgctcggtggccggcacgagcaagcgcctcacactggagctgggcggcaaggcggcgaac
atcgtgttcgacgacgcgccgatcgaccaggccgtcgagggcatcgtcaacggcatcttc
ttcaaccagggccacgtgtgctgcgcgggttcccgcctgctggtccaggagtcggtgtac
gacgaggtgctcgaagcgctcaagcggcgcatggccacgctgcgcctcggcgacccgctg
gacaagaacaccgacatcggcgcgatcaactcggcggagcagctcgaacgcatccgccgg
ctcaccgaggccggtgcggaggagggcgcggaacgctggtcggcgccgtgcgagctgccc
gcccagggcttctggttcgcgcccaccatcttcaccggcgtcacccaggcccaccgcatc
gcccgcgaggagatcttcgggccggtgctgtcggtgcttacgttccggacgccggccgag
gccatcgagaaggccaacaacactccgtacggcctgtccgccggcctctggagcgacaag
ggttcgctgatcctggcggtggccgacaagctgcgcgccggggtggtctgggccaacacg
ttcaacaagttcgacccgacctcgccgttcggcggctacaaggaatccggatacggccgt
gagggcggccgccacggtctggaggcgtaccttgcctga

DBGET integrated database retrieval system