KEGG   Actinomyces sp. oral taxon 897: C3V41_03910Help
Entry
C3V41_03910       CDS       T05399                                 

Definition
(GenBank) D-hexose-6-phosphate mutarotase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00010  Glycolysis / Gluconeogenesis
acto01100  Metabolic pathways
acto01110  Biosynthesis of secondary metabolites
acto01120  Microbial metabolism in diverse environments
acto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    C3V41_03910
Enzymes [BR:acto01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     C3V41_03910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AVM61355
UniProt: A0A2S0LMB0
Position
complement(967849..968730)
Genome map
AA seq 293 aa AA seqDB search
MSLPAPGRADAAPHLPRFTALTPGRGGQPRLLVDAPAGRAEIYLHGAQLTSWVPRAGSEV
LFTSRQAVYDGVASVRGGVPLCLPWFGLGPRGTDSPKHGWGRHVDWVLREVEPHGDGVVA
RLETEHDGVAARYEVCVGEALSLSLSLRGTGAEPVLTEMAIHTYLRVGDVTGVEITGLEG
ARYEDALDGFAWRTQGDGPLTVNGPVDRVYQCQGPVAVSDPALGRRVVSRPQGATNVVVW
NPWADLARDLADMADDEFASMVCVETASVRSHARTLAPGESWSVGVRYTVEQL
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcttcccgctccgggccgcgccgacgccgccccgcacctgccccgtttcaccgcc
ctgacccccggccggggcgggcagccccgtctcctggtcgacgccccggccggccgggcg
gagatctacctccacggcgcccagctcaccagctgggtcccgcgtgccggctccgaggtg
ctcttcacctcccggcaggccgtgtacgacggcgtggccagcgtgcgcggcggcgtgccc
ctgtgcctgccctggttcggcctcggcccccggggcacggacagccccaagcacggctgg
gggcgtcacgtcgactgggtcctgcgcgaggtcgagccccatggtgacggcgtggtcgcc
cgcctggagaccgagcacgacggcgtggccgcccgctacgaggtctgcgtgggcgaggcc
ctcagcctgtccctgtccctgcgcggcacgggggccgagcccgtcctgaccgagatggcg
atccacacctacctgcgcgtgggggacgtgaccggggtggagatcacaggtctggagggg
gcgcgctacgaggacgccctggacgggttcgcctggcgcacccagggcgacggcccgctg
acggtcaacggcccggtggaccgggtctaccagtgccagggcccggtggcggtgagcgac
cccgcgctggggcggcgcgtggtcagccggccccagggggcgaccaacgtggtggtgtgg
aacccgtgggcggacctggcccgcgacctggcggacatggccgacgacgagttcgcctcc
atggtctgcgtggagacggcctcggtacgctcccacgcgcgcacgctggcgcccggcgag
agctggtcggtgggggtgcgctacaccgtcgagcagctctga

DBGET integrated database retrieval system