KEGG   Actinomyces sp. oral taxon 897: C3V41_05805Help
Entry
C3V41_05805       CDS       T05399                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto00670  One carbon pool by folate
acto00790  Folate biosynthesis
acto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    C3V41_05805
   00670 One carbon pool by folate
    C3V41_05805
Enzymes [BR:acto01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     C3V41_05805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: AVM61647
UniProt: A0A2S0LMY8
Position
1436765..1437457
Genome map
AA seq 230 aa AA seqDB search
MVWAQDHGGVLGSAEGMLWRVPADFRHFKAVTLGGGLVMGRTTWDSLKGALVGRRNVVMT
RSEDWTAPGAHRASSLEQALALAADGLEEELGADPRTGRAASWPRTWVMGGGSVYRQAME
AGVADLLVVSTIDLDVAASLGAGRVRAGADGVTCAAAGGNTGSGTAGPDVPGVPGGLAGP
EGAVAPVLVRAPSIDLAQWERDEEDSDVLGTWRPRSGDAGWRVDVWRRRA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtctgggcccaggaccacggtggggttctggggtcggcggagggcatgctgtggcgg
gttcccgcggacttccgccacttcaaggccgtgaccctgggcggcggcctggtcatgggc
cgcaccacctgggactcactcaagggggcgctggtgggacgccggaacgtggtcatgacg
cgctctgaggactggaccgccccgggggcccaccgcgccagcagcctggagcaggccctg
gcgctggccgcggacggcctagaggaggagctgggggcggacccgcgaacgggccgggcc
gcctcctggccgcgcacctgggtaatgggcgggggcagtgtctaccgccaggccatggag
gccggggtcgcggacctgctggtggtgagcaccattgacctggatgtggccgccagcctg
ggtgccgggcgcgttagagccggagcggacggggtgacgtgcgccgcagccggtgggaac
accggttccggtacggccgggccggacgtgccaggcgtgccgggtgggttggccgggccg
gagggggcggtggcacctgtgctcgtgcgcgccccgagcattgacctcgcccagtgggag
cgtgacgaggaggacagcgatgtcctcggtacctggcgcccccgctcaggcgacgcgggc
tggcgggtggacgtctggcgccgtcgggcttaa

DBGET integrated database retrieval system