KEGG   Actinomyces sp. oral taxon 897: C3V41_06725Help
Entry
C3V41_06725       CDS       T05399                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acto  Actinomyces sp. oral taxon 897
Pathway
acto03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acto00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C3V41_06725
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acto03011]
    C3V41_06725
Ribosome [BR:acto03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C3V41_06725
  Bacteria
    C3V41_06725
  Archaea
    C3V41_06725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AVM61794
UniProt: A0A2S0LNF2
Position
complement(1633835..1634212)
Genome map
AA seq 125 aa AA seqDB search
MEAKAQAKYVRTTPMKARRIVDVVRGKRALEAVNVLRFAPQAAAVPVRKVIESAIANARF
KAERDGEQFDEHDLFIVEAYADEGPTLKRFRPRAQGRASRILKRTSHITIVVGEKADSAK
KEGAR
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaggcgcaggccaagtacgtgcgcaccacgcccatgaaggcccgccgaatc
gtggacgtggtccgcggcaagcgcgccctggaggccgtcaacgtgctccggttcgccccg
caggccgctgcggtgccggtgcgcaaggtcattgagtccgccatcgccaacgccaggttc
aaggcggagcgggacggggagcagttcgacgagcacgacctgttcattgtcgaggcgtac
gccgacgagggccccaccctcaagcggttccggccccgcgcccaggggcgcgccagccgg
atcctcaagcgcaccagccacattacgatcgtcgtcggcgagaaggccgactccgccaag
aaggaaggagcccggtaa

DBGET integrated database retrieval system