KEGG   Actinomyces gaoshouyii: B6G06_02645Help
Entry
B6G06_02645       CDS       T04911                                 

Definition
(GenBank) glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
actp  Actinomyces gaoshouyii
Pathway
actp00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:actp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    B6G06_02645
Enzymes [BR:actp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     B6G06_02645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like FAD_syn Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: ARD41404
UniProt: A0A1V0KI38
Position
668599..668991
Genome map
AA seq 130 aa AA seqDB search
MRRVITYGTFDLLHYGHIELLRRARALGDYLVVALSSDEFNAGKGKKAYFSYEERRAMLE
AIRYVDLVVPENNWEQKVDDLVKYEIDTFVMGDDWTGRFDEQLGGLCEIVYLPRTPEIST
TQIKGDMAQS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcgtcatcacatatgggacattcgatctcctgcactacggtcatatcgagctg
ctccgacgcgcgagggccctcggcgactatctcgtggtcgccctgtcgtctgatgaattc
aatgccgggaagggcaagaaggcctacttctcctatgaggagcgccgggcgatgctcgag
gccatccgctatgtcgacctggtggtacccgagaacaactgggagcagaaggtcgatgac
ctagtcaagtacgagatcgacaccttcgtcatgggtgacgactggacgggtcggttcgat
gagcagctcggcggtctgtgcgagatcgtgtacctgccccggacgcctgagatatcgacg
acacagatcaagggtgatatggcccagtcctga

DBGET integrated database retrieval system