KEGG   Actinoplanes sp. SE50: ACWT_1174Help
Entry
ACWT_1174         CDS       T05392                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00860  Porphyrin and chlorophyll metabolism
acts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ACWT_1174
Enzymes [BR:acts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     ACWT_1174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI SNO
Motif
Other DBs
NCBI-ProteinID: ATO80589
Position
1340187..1341767
Genome map
AA seq 526 aa AA seqDB search
MSDPVVAVGAGAGPQRGRQANTLLIAGTTSDAGKSILTAGICRWLHRNGVRVAPFKAQNM
SNNSVVVVAPDGRGGEIGRAQAMQAEACGLPPDLRFNPVLLKPGSDRSSQVILLGEAIDT
VTAGNYRSLRPKLAETAYATLTDLRADFDAVICEGAGSPAEINLRDGDFVNMGLARRFGM
PALVVGDIDRGGVFAAFFGTLALLSPEDQALVSGFVINKFRGDLGLLQPGIDMITAVTGR
PVHGVLPFHRDVWLDAEDSLAYGTVLGRPGPPHGREWLRVAVIRLPRISNATDAEALAAE
PGVRVHLTVEPGDVADADLVMLPGSKATVSDLAWLRETGLADAVTAHAAAGKPLVGVCGG
FQMLAGTIDDEVESGRGVTPGLGLLPVEVTFAARKTLARSAGSALGAPVGGYEIHHGQVT
REAPEAFLRYADGRPEGAVRANVYGTHWHGTFESDEFRRRFLTAAAAQAGRHGFTVAPDT
RYAAIRARALDVLGDLVAEHLDTAALWRLLENGPPPGMPFVPPGAP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccggtggtggcggtgggggcgggggcggggccccaacggggccgtcaggcg
aacacgctgctgatcgcgggcaccacctcggacgccggcaagagcatcctcaccgccggg
atctgccgctggctgcaccgcaacggcgtccgggtcgccccgttcaaagcccagaacatg
tccaacaactcggtcgtcgtcgtggccccggacggccgcggcggcgagatcggccgcgcc
caggccatgcaggccgaggcctgcggcctgccccccgacctccgcttcaacccggtcctg
ctgaagccgggcagtgaccgttccagccaggtgatcctgctcggcgaggcgatcgacacg
gtcaccgccggcaactaccggtcgctgcggcccaagcttgccgagacggcgtacgccacc
ctgaccgaccttcgtgccgacttcgacgcggtgatctgtgagggcgccggcagccccgcc
gagatcaacctgcgggacggcgatttcgtcaacatgggtctggcccgccggttcggcatg
ccggcgctggtggtcggcgacatcgaccggggcggggtgttcgccgcgttcttcggcacg
ctggccctgctctcgcccgaggaccaggcgctggtctccggcttcgtcatcaacaagttc
cgcggcgacctgggcctgctccagccgggcatcgacatgatcaccgcggtcaccggccgc
ccggtgcacggtgtgctgccgttccaccgcgacgtctggctggacgccgaggattcgcta
gcctacggcaccgtgctgggccgaccgggcccgccgcacggccgggagtggctgcgggtc
gcggtgatccgcctgccgcggatctcgaatgcgaccgacgccgaggcgctcgccgccgaa
ccgggcgtgcgggtgcatctgaccgtcgagccgggcgatgtggccgacgccgatctggtg
atgctgcccggttccaaggcgaccgtcagcgatctggcctggctgcgcgagaccgggctg
gcggacgcggtgaccgcgcacgccgcggcgggcaagccgctggtcggagtctgcggcggg
ttccagatgctggccgggacgatcgacgacgaggtggagagtgggcgcggcgtcacgccg
gggctgggcctgctgccggtggaggtcactttcgcggcccgcaagacgctggcccgcagc
gccgggtccgcgctcggggcgccggtgggtggttacgagatccaccatgggcaggtcacc
cgggaggctcccgaggcgtttctgcggtacgccgatggccggcccgagggtgcggtacgc
gcaaacgtgtatggcacgcactggcacggcacgttcgagtccgacgagttccgccgccga
ttcctgaccgcggccgccgcccaggcggggcggcacggcttcacggtcgccccggacacc
cggtatgcggcgatccgcgcccgggccctggacgtgctcggtgacctggtggccgagcac
ctggacaccgcggcgctctggcggctgctggaaaacggcccgccacctgggatgccgttc
gtgccgccgggcgccccgtag

DBGET integrated database retrieval system