KEGG   Actinoplanes sp. SE50: ACWT_1574Help
Entry
ACWT_1574         CDS       T05392                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00480  Glutathione metabolism
acts00590  Arachidonic acid metabolism
acts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ACWT_1574
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACWT_1574
Enzymes [BR:acts01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACWT_1574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ATO80989
Position
complement(1797688..1798158)
Genome map
AA seq 156 aa AA seqDB search
MTIFDVDIDALTGGTTDLDRYRGSVLLVVNVASRCGLTPQYDKLQPLYDTYRDRGLVVLG
APCDQFGHQEPGTATEIDEFCRATYGVTFPMTAKIEVNGAGRHPLYQGLVGDGPDIQWNF
EKFVVAPDGTVAARFAPGVEPDDPELVATIEKLLPH
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcttcgacgtcgacattgacgcactcaccggcggcacgaccgatttggaccgc
taccgcggatcggtgctcctggtggtcaatgtggcctcgcgctgcggactgaccccgcag
tacgacaagttgcagcccctctacgacacctaccgcgaccgcggcctggtcgtgctcggc
gccccctgtgaccagttcggccaccaggagcccggcaccgccaccgagatcgacgaattc
tgccgggccacctacggcgtcacgttcccgatgaccgcgaagatcgaggtgaacggcgcc
ggccggcacccgctctatcagggactcgtcggcgacggcccggacatccagtggaacttc
gagaagttcgtggtcgccccggacggcacggtcgccgcccgcttcgcgcccggggtcgaa
cccgacgacccggagctcgtcgcgaccatcgagaagctgctgccccactga

DBGET integrated database retrieval system