KEGG   Actinoplanes sp. SE50: ACWT_1577Help
Entry
ACWT_1577         CDS       T05392                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00260  Glycine, serine and threonine metabolism
acts01100  Metabolic pathways
acts01110  Biosynthesis of secondary metabolites
acts01120  Microbial metabolism in diverse environments
acts01130  Biosynthesis of antibiotics
acts01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ACWT_1577
Enzymes [BR:acts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     ACWT_1577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ATO80992
Position
1801268..1802287
Genome map
AA seq 339 aa AA seqDB search
MVDLRSDTVTRPTDGMREAMATAVVGDDVFGDDPTVNALEEHVATLFGHEAALFAPSGTM
ANQIALQLVTPPGGELLAGADAHVVTYELGAAALLGGISTRTWAATGAALNVDRIAAMIR
PPGFPSVPTAAIAVEQTHNLGGGGVIPLGTLRDLRAVADAHGVALHCDGARIWHAHVADG
VPLASYGALFDTLSVCLSKGLGAPVGSLVIGSRDRIARARVIRKRMGGGMRQVGILAAAG
RYALDHHVERLAEDHARARRLAEGLAPLGVVDPALVRTNLVPLDLTKAPLDAPELAAAAA
RRGVLIAAMLPKLARLVVHLDVTDDDVDEAISVLTVLLA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggttgatctgcgttccgacaccgtcacccgtccgacggacgggatgcgggaggcgatg
gccaccgccgtggtgggtgacgacgtgttcggcgacgaccccacggtcaacgccctcgag
gagcacgtcgccaccctgttcgggcacgaggcggcgctgttcgccccgtccggcacgatg
gccaaccagatcgccctgcaactggtcaccccgcccggcggcgagctgctggccggcgcc
gacgcccacgtggtcacctacgagctgggcgcggccgcgctgctcggcggcatctccacc
cgcacctgggcggccaccggcgcggcgctcaacgtcgaccggatcgccgcgatgatccgc
ccgcccggtttcccctccgtgccgaccgcggcgatcgccgtcgagcagacccacaatctg
ggcggcggcggggtgatcccgctcggcacactgcgcgacctgcgcgcggtggccgacgcg
cacggggtcgccctgcactgcgacggcgcccggatctggcacgcgcacgtggccgacggg
gtgccgctggccagttacggcgcgctcttcgacaccctgtcggtctgcctgtccaagggg
ctgggcgccccggtcggctcgctggtgatcggcagccgggaccggatcgcccgggcccgg
gtgatccgcaaacggatgggcggcggcatgcgccaggtcggcatcctggccgccgccggc
cggtacgcgctcgaccaccacgtcgagcgcctcgccgaggaccatgcccgggcccgccgg
ctcgccgagggcctcgcgccgctcggcgtggtggacccggccctagtgcgcaccaacctg
gtcccgctggacctgaccaaggccccgctggacgctccggaactggccgccgcggccgcc
cgccggggcgtgctgatcgccgccatgctgccgaaactggcccgcctggtggtccacctg
gacgtcaccgacgacgacgtcgacgaggcgatctcggtgctcaccgtgttgctcgcctga

DBGET integrated database retrieval system