KEGG   Actinoplanes sp. SE50: ACWT_3551
Entry
ACWT_3551         CDS       T05392                                 

Definition
(GenBank) 2-epi-5-epi-valiolone-7-phosphate 2-epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00525  Acarbose and validamycin biosynthesis
acts01100  Metabolic pathways
acts01110  Biosynthesis of secondary metabolites
Module
acts_M00814  Acarbose biosynthesis, sedoheptulopyranose-7P => acarbose
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ACWT_3551
Enzymes [BR:acts01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     ACWT_3551
SSDB
Motif
Pfam: AP_endonuc_2 DUF3197
Other DBs
NCBI-ProteinID: ATO82966
Position
4076683..4077495
AA seq 270 aa
MTCRVGLTEWRLAPSGAAAIRLAAAVGADGIQLDFGGPGRGVLVDGPGRAGQLRAVADEA
GVDLLALAGNLLNDIGLTSQPAVVQPVLARLADTATELGVPLLIVPSFRRSAITDAMSFT
RTAAALRWAVSLAEARGIVLASENVLPPARARQLVEEVGSPAFRLLLDTFNPVRYGLDPA
WLATELRPWWADQIHLKDGPPDTGPSPLLGAGQGGVRRTLTALRGSPAPVRALVLENDYR
DGHGARLRADLEWARRAAVNARESEKGKLT
NT seq 813 nt   +upstreamnt  +downstreamnt
gtgacctgccgggtggggctgaccgagtggcggctggcgccctcgggtgcggcggccatc
cggctggccgcggcggtcggtgccgacgggatccagctcgacttcggcggcccgggccgt
ggcgtgctggtggacggcccgggccgtgccgggcagctgcgggcggtcgccgacgaggcg
ggagtggacctgctcgcgctggccggcaacctgctcaacgacatcgggctcacgtcgcag
ccggcggtggtccagccggtgctggcccggctggccgacacggcgaccgagctcggggtg
ccgctgctcatcgtgcccagcttccggcgcagcgcgatcaccgacgcgatgtccttcacc
cgcacagcagccgccctgcgctgggccgtgtcgctggccgaggcccggggaatcgtgctg
gccagcgagaacgtcctgcccccggcgcgggcccggcagctggtcgaggaggtcggctca
ccggctttccggctgctgctggacaccttcaacccggtccggtacggactcgacccggcc
tggctggccaccgagctccggccgtggtgggccgaccagatccacctcaaggacggcccg
ccggacaccgggccgtcgccgctgctcggtgcgggacagggcggggtgcggcgcaccctg
accgcgctcagggggagccccgcaccggtacgggccctggtgctggagaacgactaccgc
gacggccacggtgcgcggctgcgagcggacctggagtgggcccgccgggccgcggtgaac
gcgagagaatccgagaaagggaagctgacgtga

DBGET integrated database retrieval system