KEGG   Actinoplanes sp. SE50: ACWT_4920Help
Entry
ACWT_4920         CDS       T05392                                 

Definition
(GenBank) 3-(3-hydroxyphenyl)propionate hydroxylase
  KO
K05712  3-(3-hydroxy-phenyl)propionate hydroxylase [EC:1.14.13.127]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00360  Phenylalanine metabolism
acts01100  Metabolic pathways
acts01120  Microbial metabolism in diverse environments
acts01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    ACWT_4920
Enzymes [BR:acts01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.127  3-(3-hydroxyphenyl)propanoate hydroxylase
     ACWT_4920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_3 DAO NAD_binding_8 Thi4 FAD_binding_2 Pyr_redox_3 Pyr_redox_2 FAD_oxidored Pyr_redox HI0933_like GIDA
Motif
Other DBs
NCBI-ProteinID: ATO84335
Position
complement(5495549..5496853)
Genome map
AA seq 434 aa AA seqDB search
MVIVGAGPTGLTAALMLARRGVGCVVLERFPEPYPLPRAVHFDDEIFRVLAGLGLAAGLH
AISRPAPGMQLVDPSLRPLATFDREPAGEHGFPQANMFDQPDLERLLRQALPHGALRAGR
QVYDVEQPPSGPVLVRYRSVEGPGELTADFVLGCDGANSLVRSLIGSTLDDLGFTQRWLV
VDAQGPDLSAYPGVQQVCDPSRAATFMMVTPGRYRWEFRLPVDRSVPSLLQPWLSGLPDP
GALSILRTAEYTFRGALASRWRDRRVFLLGDAAHLTPPFIGQGLCAGIRDAANLTWKIAF
VLSGRADERLLGTYAQERRPHARSMIRMAMLIGWVMTGGSRRSAALRRFLLRTVTRLPGA
ERRAMNVAWPAFHRGPLVGPGGGRLCPAALDESLGDGFALTGGLLIRPDRVVAAAGRHAR
KDFPAAAGIHDSGL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
gtggtgatcgtcggcgccggcccgaccggcctgaccgccgcgctgatgctggcccgtcgc
ggtgtcggatgtgtggtgctggagcgcttcccggagccgtatccgctgccccgtgccgtg
cacttcgacgacgagatcttccgcgtcctcgccggcctcgggctggcggccgggctgcac
gcgatctcccggcccgcgcccggcatgcaactggtcgatccgtcgctgcggccgctcgcc
accttcgaccgcgagcccgccggcgagcacggcttcccgcaggccaacatgttcgatcaa
ccggatctcgagcgcctcttgcggcaggcgttgccccacggagcgcttcgcgccgggaga
caggtgtacgacgtggagcagccgccgtccggtccggtcctcgtccgttaccgatcagtg
gaggggccgggtgaactgaccgccgacttcgtgctcggctgcgacggcgcgaacagcctg
gtccggtccctgatcgggtccacactcgacgacctgggcttcacccagcgctggctggtg
gtcgacgcgcagggcccggacctgtccgcgtacccgggggtgcagcaggtctgcgacccg
tcgcgggcggccaccttcatgatggtcacgcccggccgatatcgatgggagttccgcctc
ccggtcgaccggtcggtgccgtcgctgctccagccctggctcagcgggctcccggacccg
ggggcgctgagcattctgcgtaccgccgaatacaccttccgcggcgccctcgcctcccgc
tggcgggaccgccgggtcttcctgctgggcgacgccgcccacctcaccccgccgttcatc
ggccagggcctgtgcgccggcatccgggacgccgccaacctgacctggaagatcgcgttc
gtgctgtccggccgcgccgacgagcggctgctcggcacgtacgcccaggagcgtcgcccg
cacgcccgcagcatgatccggatggcgatgctgatcggctgggtgatgaccggcggcagc
cgccgctcggcggcactccgccgttttctgctacgcaccgtcaccagactgccgggcgcg
gagcgccgggcgatgaacgtcgcgtggccggcgttccaccgtggtccgctggtcggcccg
ggcggtggccggctctgcccggccgctctcgacgagtcgctcggcgacggcttcgcgctc
accggcggcctgctgatccggccggaccgggtcgtcgcggccgccggccggcacgcccgc
aaggacttcccggccgccgccggcatccacgattccggcctgtga

DBGET integrated database retrieval system