KEGG   Actinoplanes sp. SE50: ACWT_5215Help
Entry
ACWT_5215         CDS       T05392                                 

Definition
(GenBank) cellulose 1,4-beta-cellobiosidase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00500  Starch and sucrose metabolism
acts01100  Metabolic pathways
acts02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACWT_5215
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ACWT_5215
Enzymes [BR:acts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     ACWT_5215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6 CBM_2 SpoVAE
Motif
Other DBs
NCBI-ProteinID: ATO84630
Position
complement(5837092..5838867)
Genome map
AA seq 591 aa AA seqDB search
MRPISTRARALTAAAAVSVVAGAGAVAIASEASAAAGCRVDYSVNQWSTGFTGNVTVTNL
GDPISGGWNLTWDFPGNQTITQGWSATIAQSGQHVTATNPSWATSIGTNGTANFGFNANY
SGTNTAPAAFKLNGLACTGTVPNSPPPSSSGPSTGPSTGPSTGPSTGPSTNPGTKVDNPY
AGVKGYVNPEWKAKADAEPGGSRVSNNPTAVWLDRIAAIAGTSDSSSNGSMGLRDHLNAA
LAQGAGYIQLVIYDLPGRDCAALASNGELGPDDLPRYKSEYIDPIAAIEADAKYKNLRII
NIVEIDSLPNLVTNTSGQAGGTAMCDTMKANGGYVNGIGYALNKLGAIGNVYNYVDAAHH
GWIGWDSNFGPTADIMLSAAKASGNVNNVTGFITDTANYSALREPFVQPTTTVNGQSVRQ
SKWVDWNQYTDELTFAQAFRQKLISIGFNSNIGMLIDTSRNGWGGSARPTRASTSTDVNT
YVNESRIDRRIHAGNWCNQAGAGLGERPTAAPEPGIDAYVWVKPPGESDGSSSLIPNDEG
KGFDRMCDPTYTGNARNGNSMSGALPNAPISGAWFSAQFQQLMANAYPPLS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgagacccatctccacccgggcccgcgccctcacggcagccgccgccgtgagtgtcgtg
gccggcgccggcgcggtcgcgatcgcgtccgaggccagcgccgccgccggctgtcgcgtc
gattattcggtgaaccagtggagcaccggcttcaccggcaacgtcacggtcaccaacctc
ggtgacccgatctccggcggctggaacctcacctgggacttccccggcaaccagacgatc
acccagggctggagcgccaccatcgcccagtccggccagcatgtcaccgccaccaacccg
tcgtgggccacctccatcggcaccaacgggacggcgaacttcggcttcaacgcgaactac
tcgggcaccaacaccgcgccggccgcgttcaagctgaacggtctcgcctgcaccgggacg
gtcccgaactcgccgccgccgtcgtcgagcggaccgtcgaccggtccctccaccggtccg
tccaccggaccctcgaccgggccgtcgacgaacccgggcaccaaggtggacaacccgtac
gccggggtgaagggttacgtcaacccggagtggaaggcgaaggccgacgccgagcccggt
ggcagccgggtctcgaacaacccgaccgccgtctggctggaccggatcgccgcgatcgcc
ggcacctcggacagcagctccaacggctcgatgggtctgcgggaccacctgaacgccgcg
ctcgcccaaggcgccggctacatccagctggtcatctacgacctgcccggccgggactgc
gccgcgctcgcctccaacggtgagctgggcccggacgacctgccgcggtacaagagcgag
tacatcgacccgatcgccgcgatcgaggccgacgcgaagtacaagaacctgcggatcatc
aacatcgtcgagatcgactcgctgccgaacctggtgaccaacacctccggccaggccggc
ggcaccgcgatgtgcgacacgatgaaggccaacgggggatacgtcaacggcatcgggtac
gcgctgaacaagctcggtgcgatcggcaacgtctacaactacgtggacgccgcgcaccac
ggctggatcggctgggactcgaacttcggcccgaccgcggacatcatgctgagcgccgcc
aaggcgtccggcaacgtcaacaacgtgaccggcttcatcaccgacacggcgaactactcc
gcgctgcgggagccgttcgtgcagccgaccaccacggtgaacggccagagcgtccggcag
tcgaagtgggtcgactggaaccagtacaccgatgagctgacgttcgcccaggcgttccgg
cagaagctgatctcgatcggcttcaacagcaacatcggcatgctgatcgacacctcgcgc
aacggctggggcggctcggcccggcccaccagggcgagcacctcgaccgacgtcaacacc
tacgtcaacgagtcgcgcatcgaccgccggatccacgccggcaactggtgcaaccaggcc
ggcgccggcctgggtgagcggcccaccgcggctcccgagccggggatcgacgcctacgtc
tgggtgaagcccccgggtgagtccgacggctcctcctcgctgatcccgaacgacgagggc
aagggcttcgaccggatgtgcgacccgacctacaccggcaacgcccgcaacggcaacagc
atgagcggtgccctgccgaacgccccgatctccggggcctggttctccgcccagttccag
cagctgatggccaacgcgtacccgccgttgtcctga

DBGET integrated database retrieval system