KEGG   Actinoplanes sp. SE50: ACWT_5606Help
Entry
ACWT_5606         CDS       T05392                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
acts  Actinoplanes sp. SE50
Pathway
acts00030  Pentose phosphate pathway
acts00480  Glutathione metabolism
acts01100  Metabolic pathways
acts01110  Biosynthesis of secondary metabolites
acts01120  Microbial metabolism in diverse environments
acts01130  Biosynthesis of antibiotics
acts01200  Carbon metabolism
Module
acts_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
acts_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:acts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ACWT_5606
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACWT_5606
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acts04147]
    ACWT_5606
Enzymes [BR:acts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     ACWT_5606
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     ACWT_5606
Exosome [BR:acts04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ACWT_5606
  Exosomal proteins of colorectal cancer cells
   ACWT_5606
  Exosomal proteins of bladder cancer cells
   ACWT_5606
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ATO85021
Position
6272317..6273969
Genome map
AA seq 550 aa AA seqDB search
MGPVTAYRGKQVLILGVLGHAGRMSDDGSSADKASAADSAHAPERTDAAATGKTDATGAA
ATGKTDAADATDAGAVTEKADAAAAEKAGPAAPEKAGPVDKGAQTLVILGASGDLTGRLL
LPGLGALVAAGEAPPLTLIGAGMDDWDAQKWRERVTGAFPESPAGKTVIDGTRYVRADVT
RSEDLRGLLEGADRPVIFFALPPAVTAKACEALLDVDLPDGTRLVLEKPFGTGANSAAAL
NRLLTRLVPEERIHRVDHFLGKSTVLNILGLRFANRIFEPLLGSEHVESVDIIFDENLGL
ENRAGYYDRAGALADMIQSHLLQILALLSMEPPTSLDPQDFRDRTAEALRATRLWGGDPK
TASLRARYTAGDLDGRQLPAYADEAGVDPSRETETLAELVLAVDTWRWAGVPFRLRSGKA
VGSSRKEAIITFKEPPRLPTGLHGPERPNRLRIGFGPDRFALDFTVNGPGDPFELDPVTL
ETDFGPGDLPPYGEVLHGVFDDDPLLSVRGDTAEQCWRIVEPVTAAWRDGQVPLVEYPAG
SAGPAETLLQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggggccggtcacggcgtaccgcggcaagcaggttttgatcttgggggttttggggcat
gcgggacgcatgagtgatgacggctcctcggcggacaaggccagcgcggcggacagtgcg
cacgcgccggagaggacggatgcggcggcgaccggaaagacggacgcgacgggcgcggcg
gcgaccggaaagacggacgcggcggacgcgacggacgcgggggcggtgaccgagaaggcg
gacgcggcggcggcggagaaagctggaccggcggcacccgagaaagcgggcccggtggac
aagggcgcgcagacgctggtgatcctcggggcatccggcgacctgaccggacgcctcctg
ctgccgggtctcggcgcactggtcgcggccggtgaggcgccgccgctgacgctgatcggt
gccgggatggacgactgggacgcgcagaagtggcgggagcgggtgaccggagcgttcccg
gagagcccggccggtaagacggtcatcgacgggacccggtatgtgcgggccgacgtgacc
cggtccgaggatctgcggggtctgctggagggcgccgaccgcccggtgatcttcttcgcg
ctgccgcccgcggtgaccgcgaaggcgtgcgaggcgctgctcgacgtggaccttccggac
ggcacccggctggtgctggagaagccgttcgggaccggtgcgaactcggcggcggcgctg
aaccggctgctgacccggctggttccggaggagcggatccaccgggtggaccacttcctc
ggcaagtcgaccgtgctgaacattctcggtctgcgattcgcgaaccggatcttcgagccg
ctgctcggctcggagcacgtggagagcgtcgacatcatcttcgacgagaatctgggcctg
gagaaccgcgccggttactacgaccgggcgggcgcgctcgctgacatgatccagagtcat
ctgctgcagattctggcgctgctcagcatggagccgccgacgtcgctggatccgcaggat
ttccgggaccggaccgcggaggcgctgcgggcgacccggctgtggggcggcgatccgaag
acggcgagcctgcgggcccggtacacggccggggatctggacggccggcagcttccggcg
tacgccgacgaggccggggtggatccgtcgcgggagaccgagacgctggccgagctggtg
ctggcggtggacacctggcggtgggccggggtgccgttccgcctgcggtcgggcaaggcg
gtgggcagcagccgcaaggaggcgatcatcaccttcaaggagccgccgcggctgccgacc
gggctgcacggaccggagcggccgaaccggctgcggatcggtttcggaccggaccggttc
gcgctggacttcaccgtgaacgggcccggcgacccgttcgaactggacccggtgacgctg
gagaccgacttcggcccgggcgacctgccaccgtacggcgaggtgctgcacggcgttttc
gacgacgacccgctgctgtcggtgcgcggtgacacggccgagcagtgctggcggatcgtc
gagccggtgaccgcggcatggcgggacggtcaggtgccgctggtggagtatccggccggg
agcgccgggccggccgagacgctactgcagtag

DBGET integrated database retrieval system