KEGG   Actinobaculum sp. 313: DDD63_02710Help
Entry
DDD63_02710       CDS       T05430                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
actt  Actinobaculum sp. 313
Brite
KEGG Orthology (KO) [BR:actt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DDD63_02710 (mca)
Enzymes [BR:actt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     DDD63_02710 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AWE41849
Position
623065..623940
Genome map
AA seq 291 aa AA seqDB search
MATERRLMAVHAHPDDESSKGAGMMAKYAQVGRVRVVTCTGGERGSILNPHFVPAYPDEP
MTDIRRREMAQAAQALGIEHHWLGFVDSGLPDGYPDVELPGGCFAVQPLEIPVKALVSQI
REFRPQVLTCYDERGGYPHPDHVRSHVVAMEAVRKAADPGLWPELGEAWQVSKVYYDLTF
NARRLRTLDRAIRRAGHESPYASLVSAREDLPEAAPSARINVGDFFPQRDAALRAHASQI
DPEGFFFACPRDIEKENWPWEEFVLALSMVGEPSGIVDDLFARVPGVEHVP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaacgacgcctcatggctgtgcatgcgcatccggacgacgaatcgtccaaa
ggtgcgggaatgatggcgaaatacgcccaggtggggcgagtccgagtagtcacctgtacc
ggcggcgagcggggctccatcctcaacccgcatttcgtgcccgcttaccccgacgagccg
atgacggatattcgacggcgggaaatggcgcaggccgcgcaagcgctcggaattgagcat
cactggttgggcttcgtggactcagggctgccggacggctacccggatgtggagctgccc
gggggctgcttcgccgtccaaccgctggagattccggtgaaggcgctggtttcgcagatt
cgagagttccgcccgcaggtgctgacctgctatgacgagcgtggcggctacccgcatccg
gaccatgtgcgttcgcacgtggtcgccatggaagcggtacgtaaggctgccgatcccggg
ctgtggccggagctgggcgaagcctggcaggtctcaaaggtctattacgatctcaccttc
aatgcgcggcggttgcgtaccctggatcgggcgatccggcgcgccggccacgaatcgccg
tatgcgtcgctggtctccgcgcgcgaggaccttccggaggcagcgccgtcggcccggatc
aacgttggcgatttcttcccacagcgcgacgccgccctgcgcgctcacgcctcgcagatc
gacccggagggcttcttcttcgcctgcccgcgtgatatcgagaaggagaactggccgtgg
gaggaatttgttctcgcactgtccatggtgggggagccgagcgggatcgtcgatgatttg
ttcgcacgagtgccgggcgtggaacatgtgccgtga

DBGET integrated database retrieval system