KEGG   Actinobaculum sp. 313: DDD63_10140Help
Entry
DDD63_10140       CDS       T05430                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
actt  Actinobaculum sp. 313
Brite
KEGG Orthology (KO) [BR:actt00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DDD63_10140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 HemY_N
Motif
Other DBs
NCBI-ProteinID: AWE43038
Position
2354118..2355119
Genome map
AA seq 333 aa AA seqDB search
MSGTLILVCIILLVCMVFDFTNGFHDAANAIATSVATRALSPRAALTMAAIMNFIGALLG
TGVAETIGSGIIDPAVGTDGLLVVFGALIGAVTWNLITWWFGLPSSSSHALIGALAGAGV
ASATTVHWSVIFDKVIIPMILSPAVGFIVAFVLMKMVLRLLANAPYRSTMHHFRHAQTAS
AAAMALGHGLQDAQKTMGVVVMALVAGGYHHDMSIPLWVKLVAAAAISAGTYSGGWRIMK
TLGQKIIDLDPARGFVAEGIAATVLYGTAFLWHAPISTTHTITCAIMGVGATKRRSAVRW
GVAGNIVAAWIFTLPCAGLVGGAATALMRLIAL
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
ttgagcggcacacttattctagtctgcatcattctgctcgtatgcatggttttcgacttc
accaacggtttccacgacgccgccaacgctattgccacctccgtggcgacgcgcgcactc
tccccacgcgccgcgctaaccatggccgccatcatgaacttcattggcgccttactcggc
accggcgtcgccgaaacaattggcagtggaatcatagatccagcggttggaactgacggc
ctgttagtcgtctttggcgcgctaataggtgcagtgacgtggaacctcatcacctggtgg
ttcgggctgccgtcctcgtcatcgcacgcactcatcggagctctcgccggtgccggcgtc
gcctcggctacaactgtgcactggagtgtcatcttcgacaaggtcatcattccgatgatt
ctctcccctgcggtcggcttcattgtcgcgtttgtgctaatgaaaatggtactgcgtctg
ctggctaatgccccctaccgcagcacgatgcatcacttccggcacgcccaaacagcatcg
gctgccgccatggcactgggacatggcttgcaggatgcccagaaaaccatgggcgtggtc
gttatggcgctggtggccggcggataccaccacgacatgagtatcccactatgggtcaag
cttgttgctgcggcggccatctcagctggcacttacagcggtggctggcgcattatgaag
accctcggacagaagatcatcgatctggatcccgcccggggctttgtcgccgaaggtatc
gcggcaaccgtgctgtacggcaccgcattcctgtggcacgctcctatctcgaccacacac
accattacctgcgcaatcatgggagtgggtgcgacgaagcggcgctccgccgtgcgctgg
ggtgttgcgggaaatatcgtggctgcctggatcttcactctgccatgcgccggacttgtg
ggaggcgcggcgacggcgctcatgcggctcatcgctttgtag

DBGET integrated database retrieval system