KEGG   Acidithiobacillus caldus SM-1: Atc_0242Help
Entry
Atc_0242          CDS       T01581                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00520  Amino sugar and nucleotide sugar metabolism
acu01100  Metabolic pathways
acu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:acu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Atc_0242
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Atc_0242
Enzymes [BR:acu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Atc_0242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AEK56893
UniProt: F9ZQA5
Position
complement(252442..253428)
Genome map
AA seq 328 aa AA seqDB search
MVDLGGSELDAAERELLQDPAIGGVILFARNCLSALQVAELCREIRALRQPPLLIGIDQE
GGRVQRLREGVTRFPPQRALGRLAEAEGIESAIDLARDWGRLLAAELRDLGIDLDFTPCV
DIDWGVSEVIGDRALSDRPEWVAQLAGALWSGLQEQGLAGVAKHFPGHGAVTADSHTSLP
EDLRPWPLLQADLKPFRTLIAAGIPAIMPAHCLYPAVDPRNPAGFSRRWLQDILRGELGF
HGILVSDDLVMAGAAVVGGMAERVHAAQSAGAELLLVCNDRQAVEESLAVLHRGDLPAPR
LENLSARPATSPLSPAARDAIRTRLAKL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtggacctggggggcagcgagctggacgctgccgagcgcgagctcctgcaagatccg
gccatcggcggcgtcatccttttcgcccgtaactgtctgtcggccctgcaggtggcagag
ctttgtcgggagatacgggccttgcgccagccaccgttgctcatcggcatcgatcaggag
ggcgggcgggtgcagcgcctgcgcgagggcgttacccgctttccaccgcagcgcgctctg
ggacgtctggccgaggcggaagggatcgagagcgccatcgatcttgcccgcgactggggt
cgactgcttgccgctgagttgcgcgatctgggtatcgacctcgattttacgccctgtgtg
gatatcgactggggagtttccgaggtcattggcgatcgggccctgagcgaccggccggag
tgggtagcgcagttggcaggagcgctatggtctggcctgcaggaacagggccttgccggt
gtcgccaagcattttccgggacacggcgcagtgacggcggattcgcacaccagcctgccc
gaagacctccgtccctggccactgctgcaagcggatctgaagccttttcgtaccctcatc
gctgccggcatccccgccatcatgccggcgcactgcctctaccccgccgtcgaccccaga
aaccccgcaggcttctcgcgccgctggttgcaggacatcctccgtggggaattgggcttt
cacggaatcctcgtcagtgacgacctggtcatggccggggcggcggtggtggggggcatg
gccgagcgcgtgcacgcggcccagagcgcgggtgccgaactgctgctggtctgcaacgac
cggcaggcagtggaggaatccctggcggtcctgcatcgcggtgacctgcctgcgccgcga
ctggaaaacctttccgctcgcccggcgacatcaccgctcagccccgctgcgcgggatgcg
atccggacacgccttgccaagctctga

DBGET integrated database retrieval system