KEGG   Acidithiobacillus caldus SM-1: Atc_0311Help
Entry
Atc_0311          CDS       T01581                                 

Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00260  Glycine, serine and threonine metabolism
acu00750  Vitamin B6 metabolism
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01120  Microbial metabolism in diverse environments
acu01230  Biosynthesis of amino acids
Module
acu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Atc_0311
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Atc_0311
Enzymes [BR:acu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Atc_0311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEK56962
UniProt: F9ZTE1
Position
330903..332033
Genome map
AA seq 376 aa AA seqDB search
MTRYTGIIDRYRPYLPLAPETEAVSLCEGNTPLIECQHLPKVLGLELRLFLKFEGLNPTG
SFKDRGMTMAVTKAREEGSEMIICASTGNTSAAAAAYAARAGMRAFVVIPEGKIALGKLS
QAMMHGALVLQIRGNFDAGMRIVQEVAQTEPITLVNSVNPYRLQGQKTAAYEIIEALGGA
PDYHALPVGNAGNITAHWVGYCEASDGRADPAQSLTEACKFCDGQCPYGHGGPGKRPKML
GFQAAGSAPFMAGEFIREPETIATAIRIGHPMSWHQAHAVVRESGGWFAAHSDAEILEAQ
RWLAQHEGVFCEPASATSVAGVVAAARAGKIEAGARVVCTLTGHGLKDPDVAIAQGGKVH
TVDADLDAVQRAILRD
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgactcgatataccggcatcatcgaccgttaccgaccctatctacccctagccccagag
accgaggccgtaagcctctgtgagggcaacacgccgctcatcgagtgccagcacctacca
aaggttctgggactcgagctgcgcctctttctgaagttcgaggggctcaatcccacgggt
tccttcaaggatcgcggtatgaccatggccgtgaccaaggcgcgtgaggagggtagcgag
atgatcatctgcgcctccacgggcaatacctcggcggcggcagcggcctacgccgcacgc
gctggcatgcgcgccttcgtggtcatcccggagggcaagatcgccttgggcaagctatcc
caggccatgatgcacggcgccctggtgttgcagatccgtggcaacttcgatgccggtatg
cgtatcgtccaggaggtggcgcagactgagcccatcaccctggtgaattccgtcaacccc
taccgcttgcaggggcagaagaccgccgcctatgagatcatcgaggcactggggggggct
cccgactaccacgcgctgcccgtgggcaacgccggcaatatcaccgcccactgggtgggg
tactgtgaggcaagcgacggtcgcgccgatcccgcccagagccttacggaagcctgcaaa
ttctgcgacggacagtgtccctacggccacggtggtcctggcaagcgcccgaagatgctg
ggctttcaggccgctggcagcgcccccttcatggctggggagtttattcgtgagcccgag
accatcgctacggccattcgtatcggtcaccccatgtcctggcatcaggcccacgccgtg
gtgcgcgagagcggcggttggtttgccgcccacagcgatgcggagattctcgaggcgcag
cgctggctggcgcagcacgagggggtcttctgtgaaccggcctctgctacctccgttgcc
ggggtcgtcgcggccgcccgcgcgggcaagatcgaggcgggggcgagggtggtctgtacc
cttacgggccacggtctgaaggatccggacgtggccatcgcccagggcggcaaggtgcac
acggtggacgccgatctggacgccgtgcagcgagccatactccgggattga

DBGET integrated database retrieval system