KEGG   Acidithiobacillus caldus SM-1: Atc_0412Help
Entry
Atc_0412          CDS       T01581                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00450  Selenocompound metabolism
acu00970  Aminoacyl-tRNA biosynthesis
acu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Atc_0412
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Atc_0412
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acu01007]
    Atc_0412
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acu03016]
    Atc_0412
Enzymes [BR:acu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Atc_0412
Amino acid related enzymes [BR:acu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Atc_0412
Transfer RNA biogenesis [BR:acu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Atc_0412
 Prokaryotic type
   Other AARSs
    Atc_0412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AEK57063
UniProt: F9ZSP8
Position
complement(424514..426556)
Genome map
AA seq 680 aa AA seqDB search
MKRKILVTSALPYANGPLHLGHLVEYTQTDIWVRYHKLRGHDCVYVCADDAHGTPIMLRA
QSEGISPETLVERMQKEHLRDFTAFGIGFDCYHSTHSPENFTISQDIYRRLRAAEHIVVR
EIEQAFDPVAGIFLPDRFIRGTCPKCGAADQYGDNCEVCGATYSPTDLVDAVSAVSGATP
VRRPTEHYFFTLSDFADFLQEWIHSGTLQEEMANKLDEWFKAGLADWDISRDAPYFGIPI
PDTEGKFFYVWLDALPGYMAATTHWCEEHGRDFDTYWGAQAQSEVYHFIGKDIIYFHALF
WPAMLKGAGYRLPTAIFTHGFMTVNGAKMSKSRGTSITAARYLERLEPEFLRYYFASKLN
PRPEDIDLNLEDFLLKGNGDLVGKVVNLAARSAGFIHQFGGGRLAPSLGEDATFYAELAG
QRERIGAAYAERDYARAIRDIMAMADRVNAYVDRHAPWQLAKDPAQREVLLRVATTTLNA
FRLLITLLSPVVPQLARRSLDFLHCPLDWDSLAEPLLDHHIAPYQHLLQRMEKSTVDSLI
ASPTPAQTPKDKAAEERSPEAASGTQATQAPATISIEDFSRVELRVARIVAAEAVEGADK
LLRLTLDIGEEKPRQVFAGIKSAYRPEDLQGRLTVMVANLAPRKMRFGLSEGMVLAASGP
TGGPFLLAPDSGAEPGMRIK
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaagatcctggtcaccagcgcccttccctatgccaatggtcctctgcacctt
ggccatctcgtcgagtacacccagacggacatctgggtccgttaccacaaactgcggggc
cacgactgcgtctacgtctgcgccgacgatgcccacggcacccccatcatgctgcgcgcc
cagagcgaggggatctcgccggaaaccctggtggaacgcatgcagaaggaacatctgcgt
gacttcaccgccttcggcatcggtttcgactgctatcacagcacccactcgccagagaac
ttcaccatttcccaggatatctaccggcggctgcgggcagccgagcacatcgtcgtgcgc
gagatcgagcaggcctttgatcccgtagccggcatcttcttgccggaccgcttcatccgc
ggcacctgcccaaaatgcggcgccgccgatcagtatggcgacaactgcgaggtctgtggt
gctacctacagccccaccgatctcgtggatgccgtctcagccgtctccggcgccaccccc
gtgcggcgccccacggagcactatttcttcaccctgagcgactttgccgactttctgcag
gagtggatccacagcggcacgctgcaggaggagatggccaacaagctcgacgagtggttc
aaggccggtctggccgactgggacatcagccgcgatgccccctacttcggtattcccatt
cccgataccgagggcaaattcttctacgtctggctggatgctttacccggttacatggcg
gcaacgacccactggtgcgaagagcacggccgggatttcgatacctactggggagcccag
gcccaaagcgaggtctaccacttcatcggtaaggacatcatctatttccacgccctcttc
tggccggccatgctcaagggtgcgggctaccgcctgcccacggccatcttcacccacgga
ttcatgaccgtgaacggtgccaagatgagcaaatcccgcggcacctccatcaccgctgcc
cgatatctggagcgcctggagccggagttcctgcgctactacttcgccagcaagctcaat
ccgcgtccggaggacatcgacctcaacctcgaggatttcctgcttaagggcaacggcgac
ctggtgggcaaggtggtcaatctcgccgcccgcagcgccggattcattcaccagttcggt
ggcggtcgccttgccccgagtctgggcgaggacgccaccttctacgccgaactggcagga
cagcgggaacgaatcggtgccgcctacgccgagcgcgactacgcgcgcgccattcgcgac
atcatggccatggccgatcgcgtcaacgcctacgtcgatcgccatgcgccctggcaactg
gcaaaggatcctgcacagcgcgaggtcctgttgcgggtggccaccaccacgctcaatgcc
tttcgtctgctgatcactctgctgagcccggtggtaccgcagctcgcccgccgttccctg
gatttcctgcactgcccgctggactgggatagccttgccgagccgctgctggatcaccac
atcgccccctaccagcacctcctgcaacggatggagaaaagcaccgtggacagcctcatc
gccagccccacgccggcgcaaacccccaaggacaaggcagccgaggagcgcagtcccgag
gcggcgagtggcacccaggcaacccaagccccggccaccatttccattgaagacttttcc
cgcgtggagctgcgcgtggcccgcatcgttgcggcagaggccgtggaaggggcggacaag
ctcctgcgcctcaccctcgacattggcgaggaaaagccgcgtcaggtctttgccggtata
aagtccgcctaccgtcccgaggacctgcaggggcgcctgacggtcatggtggccaatctc
gcgccgcgcaagatgcgttttggcctgtccgagggcatggtgcttgccgccagcggcccc
acgggcggaccctttctgctggctccagacagcggcgctgagcccggtatgcgtatcaaa
tag

DBGET integrated database retrieval system