KEGG   Acidithiobacillus caldus SM-1: Atc_0610Help
Entry
Atc_0610          CDS       T01581                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu03010  Ribosome
Brite
KEGG Orthology (KO) [BR:acu00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Atc_0610
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:acu03011]
    Atc_0610
Ribosome [BR:acu03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Atc_0610
  Bacteria
    Atc_0610
  Archaea
    Atc_0610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEK57259
UniProt: F9ZM48
Position
617819..618151
Genome map
AA seq 110 aa AA seqDB search
MRSSAVLKGLQMSPQKARLVADLVRGQPVAKALEILQFTNKKAALPIRKCLESAVANAEN
NEGADVDALVVESIQIDGGTVLKRFAARAKGRGSRILKRTSHITIVVAEH
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgagatccagcgctgtactcaaaggattgcagatgtcgccgcagaaggcgcgcctggtg
gccgacctcgtgcgtggtcaaccagtggccaaggccctggaaatcctgcagttcacgaat
aaaaaggcggccctgcccattcgcaagtgtctcgagtcagcggtggcgaacgcagagaac
aacgaaggggcggacgtggatgccctggttgtggagagcattcagatcgacggtggtacg
gtactgaagcgcttcgcggcccgcgccaaaggtagggggtcgcggattctcaagcgtacc
agccacatcaccatcgttgtcgctgaacactaa

DBGET integrated database retrieval system