KEGG   Acidithiobacillus caldus SM-1: Atc_1325Help
Entry
Atc_1325          CDS       T01581                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00010  Glycolysis / Gluconeogenesis
acu00020  Citrate cycle (TCA cycle)
acu00620  Pyruvate metabolism
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01120  Microbial metabolism in diverse environments
acu01130  Biosynthesis of antibiotics
acu01200  Carbon metabolism
Module
acu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Atc_1325
   00020 Citrate cycle (TCA cycle)
    Atc_1325
   00620 Pyruvate metabolism
    Atc_1325
Enzymes [BR:acu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Atc_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 PYNP_C
Motif
Other DBs
NCBI-ProteinID: AEK57974
UniProt: F9ZN06
Position
complement(1347946..1349232)
Genome map
AA seq 428 aa AA seqDB search
MKQAVTMPVLSDTMETGRLVRWNKAVGDPVKKGEAIAEVETDKAILDVEAFADGFLAGPL
APVDEDIPVRQTIAYIVDSQEAAKTEATDARTTSATETPAPTPKADSAAESTNPASPRAA
PAKAAAEVATDVQNGTPAAISTPVATNLSGTDDFSPAASAPAESRSTGSPRVPASPYARA
LARDLGVDLEHLRPGPDGRIHGAEVLAAAMAGSEPDLRYGPPHRLERLRPMRAAVARNMT
ATLHTPTFQIGSRLALQTLHERAKARKVSLTLALARACALTVAEDPWFNHVWTPAGLAQR
ERVDVGIAVDTGDGLVTPVLRDAARRPLQELAEDWRILLGKTRKGRLAPEDYEGATFYLS
NLGVFPHITHFNAIVPSGASAILAVSASDTQGQTDFTLSCDHRVIFGADAARFLGRLAER
LEQVQWLD
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaggccgttaccatgccggtgctgtcggacaccatggaaactggacgcctggtg
cgctggaacaaggccgtaggggaccccgtcaagaaaggcgaagccatcgccgaggtggaa
acggacaaagcgattctggacgtcgaagcctttgccgacggttttctggcgggtcccctg
gcgcctgtggatgaggacattcccgtacgccagaccattgcctacatcgtcgattcgcag
gaagcggcaaaaaccgaggccaccgatgcccgcaccacgtccgcaaccgaaactcctgcg
cccacgccaaaggcggacagtgctgccgagagcaccaatccggcttcgcccagagccgcg
ccggcaaaggcggccgccgaggtcgccaccgatgtgcagaacggcacgccggccgccatt
tccaccccagtcgccacgaacctgtccgggaccgacgatttcagccccgccgcatcggca
ccggcggaatcgcgatccacgggctcccccagggtgccagcctcgccctacgcccgagcc
ctggcccgggatctgggtgtcgacctggaacacctgcgtcccggccccgacggtcgaata
cacggggcggaagtccttgccgcggccatggccggatccgaacccgacctgcgctacggg
cctccacaccgactggagaggctgcggcccatgcgggcggccgtcgcgcgcaacatgacg
gccacgctccataccccgactttccagatcggctcccgcctcgccctgcaaaccctccac
gagcgggccaaagcacgcaaagtgagtctcaccctcgccctggctcgggcctgcgccctc
accgtcgccgaagatccctggttcaaccacgtctggacgccggcggggctcgcccagcgc
gagcgcgtcgatgtcggcatcgccgtggatacgggcgacgggctggtcacccccgtcctg
cgggacgccgcccgtcgtcccctccaggagctggcggaggattggcggattctcctcggc
aagacccgcaaaggacgtctggcgccggaggattacgaaggggcgaccttctacctctcc
aatctgggcgttttcccccacattacgcacttcaacgccatagtccccagtggggcctct
gccatcctggcggtatccgccagcgacacccaggggcaaacggactttaccttgagctgt
gaccaccgggtgatcttcggtgccgatgccgcccgctttctcgggagactggcggaacgc
ttggagcaggtccagtggctggattag

DBGET integrated database retrieval system