KEGG   Acidithiobacillus caldus SM-1: Atc_1763Help
Entry
Atc_1763          CDS       T01581                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00564  Glycerophospholipid metabolism
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
Module
acu_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:acu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Atc_1763
Enzymes [BR:acu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Atc_1763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AEK58411
UniProt: F9ZP24
Position
complement(1818863..1819525)
Genome map
AA seq 220 aa AA seqDB search
MNRKARILGIALEGWPFILAFLALTALLWCLAGLWWSLPMLLLSLFSLQFFRDPQRPLPE
ALAGGVLCPADGRVIAIEQVEDPYLQRPAIKISIFMNVFDVHVNRTPVAGLVRGVWYFPG
RFFNAALAKASLENERNALWLQSEFGQDVTVVQVAGLVARRILCYLRQGDVAELGGRLGF
IRFGSRVDTYLPLGSQLRVSLGDKVRSGAQWLAVLPETQA
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggaaagctcggattcttggcattgccctggaggggtggcctttcatcctggcc
ttcctcgcccttactgcgctgctctggtgcctggcgggtttgtggtggagcctgcccatg
ctactgctcagccttttcagcctccagttctttcgagatccgcagcgcccactgcccgag
gcgctggctggcggcgtactctgtccagcggatgggcgagtcatcgccatcgagcaggtg
gaagatccctatctccagcggcctgccatcaagatcagtattttcatgaacgtctttgat
gtgcacgtcaaccgtacaccggtggcgggattggtgcggggtgtctggtactttcccggg
cgcttcttcaacgctgctctggccaaggcatccctggagaacgagcgtaacgccctgtgg
ctgcagagtgagttcgggcaggatgttaccgtggtgcaagttgcaggcctcgtcgctcgg
cggattctgtgttacctgcgtcagggtgatgtggcggaactgggcggaagactcggcttc
attcgctttggatctcgggtcgatacctatttgcctctgggtagccagctgcgggtgagt
ctgggggacaaggtgcgttcgggagcccagtggctggccgttttgcccgagacccaggcg
tga

DBGET integrated database retrieval system