KEGG   Acidithiobacillus caldus SM-1: Atc_2439Help
Entry
Atc_2439          CDS       T01581                                 

Definition
(GenBank) Succinyl-CoA ligase ADP-forming beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
acu  Acidithiobacillus caldus SM-1
Pathway
acu00020  Citrate cycle (TCA cycle)
acu00640  Propanoate metabolism
acu00660  C5-Branched dibasic acid metabolism
acu01100  Metabolic pathways
acu01110  Biosynthesis of secondary metabolites
acu01120  Microbial metabolism in diverse environments
acu01130  Biosynthesis of antibiotics
acu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Atc_2439
   00640 Propanoate metabolism
    Atc_2439
   00660 C5-Branched dibasic acid metabolism
    Atc_2439
Enzymes [BR:acu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Atc_2439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AEK59087
UniProt: F9ZRS2
Position
complement(2493416..2494579)
Genome map
AA seq 387 aa AA seqDB search
MNLHEYQAKRLLAEAGVTVPRGIPAFSLKEAINQARELGGPRWVVKAQVHAGGRGKAGGV
RVVDSIAAVEQAAQALLGKPLVTAQTGPEGQHVAALLIEEPSVLLREFYLALVVDRASAR
MRFVASDRGGVEIEELAREQPQAIASITIDPRVGFLPYQGRQLGFAWGLEPAAVQQLVRT
MQAMARLAPQLDALMIEINPLALTAEGRLLALDAKISMDDNALYRHPESDELFDSTQQDG
REITARQFGLNYISLGGNIGCMVNGAGLAMATMDLIKLHGGEPANFLDVGGGAAADKVTQ
AFKLILSDQRVRAILVNIFGGITRCDLLAQGILQAAREVGIHLPVVVRLEGTNREEGLAL
LRESGLALITAEGLDDAAAKAVAAAAG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaatctgcacgaataccaggccaagcgtctgctggcagaggccggggtgaccgtgccc
cgggggatccccgccttttccctgaaggaagccatcaatcaggcgcgtgagttgggtggg
ccacgctgggtggtcaaggcccaggtccacgctggcggccgcggcaaggccggcggtgtg
cgggtggtggacagcatcgccgccgtggagcaggcggcccaggcgcttctgggaaaaccg
ctggtgacggcacagaccggaccggaaggtcagcacgtggcagcactgctcatcgaggag
cccagtgtcctcctgcgcgagttctatctggccttggtggtggatcgagccagcgcccgc
atgcgtttcgtggcctcggaccggggcggagtggagatcgaggagcttgcccgggagcag
ccccaggccattgcttccatcaccatcgatccgcgcgtgggttttctgccctatcaaggg
cggcagctgggttttgcctggggcctcgaacccgccgcggtccagcaactggtccgtacc
atgcaggccatggcccgcctggcgccgcagctggacgcgctcatgatcgaaatcaatccc
ctggccttgacggccgaaggtcggctcctcgctctcgatgccaagatcagcatggacgac
aacgccctctatcggcatcccgagtccgatgagctcttcgattccacgcagcaggatggg
cgcgagatcacagcacgtcagttcggcctcaattacatctcgttgggtggcaacattggt
tgcatggtcaatggcgcggggttggccatggcgaccatggatctcatcaagctgcacggt
ggtgagcccgccaatttcctggacgtgggcggtggagcggcggcggacaaggttacccag
gccttcaagctcatcctctcggatcagcgggtgcgcgctatcctcgtcaatatcttcggc
ggaatcacccgctgcgatcttctggcccagggtattctgcaggcggcccgggaggtgggt
atccacctgccggtggtggtgcgcctggagggcaccaatcgcgaagagggacttgccctc
ttgcgcgagagtggcctggccctcatcaccgccgagggactggacgacgcagcggccaag
gcggtggcggccgccgccggctga

DBGET integrated database retrieval system