KEGG   Athene cunicularia (burrowing owl): 113476218Help
Entry
113476218         CDS       T05777                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00350  Tyrosine metabolism
acun00360  Phenylalanine metabolism
acun00380  Tryptophan metabolism
acun01100  Metabolic pathways
Module
acun_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113476218 (DDC)
   00360 Phenylalanine metabolism
    113476218 (DDC)
   00380 Tryptophan metabolism
    113476218 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acun04147]
    113476218 (DDC)
Enzymes [BR:acun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     113476218 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     113476218 (DDC)
Exosome [BR:acun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113476218 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 113476218
NCBI-ProteinID: XP_026697357
Position
2
AA seq 488 aa AA seqDB search
MDAAEFRKRGKEMVDYIADYLEKIEKRQVFPDVEPGYLRPLIPDCAPQDPESFEDVFKDI
EKIIMPGVTHWHSPYFFAYFPAASSFPALLADMLCGGIGCVGFSWAASPACTELETVMLD
WLGKMINLPEEFLAGKDGQGGGVIQGSASEATLISLLAARTKTIRRVQLEKPELTEADIM
GRLVAYASDQAHSSVERAALIGGVKMKNVSSDDTFSVCGSALKKVLDEDKASGLIPFFFC
ATLGTTPCCSFDKLLELGPICNKENIWMHIDAAYAGSAFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRSDLTGAFKLEPLYLQHHHQESGLVTDYRHWQIPLGRRFRSL
KLWFVLRMYGVTGLQDHIRKHVRLSHQFEHLVLQDERFEICAEVVLGLVCFRLKGSNELN
KALLKSINEAKKIHLVPCHLRETFVLRFAICSRTVESTHIKFAWQHISQLATALLKTWEQ
NHHQQLQQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcagagttccgcaagagagggaaggagatggtggactatattgcagattac
ctggagaagatagagaaaagacaggtcttcccagatgtggaaccaggatatctaaggccc
ctcattccagactgtgcaccccaggatcctgagagctttgaggatgtctttaaagacata
gagaagatcattatgccaggggtgactcactggcacagtccatacttctttgcctacttc
cctgcagcctcttccttcccagctcttcttgcagatatgttgtgtggtggaataggatgt
gtgggcttctcttgggccgcaagtccagcctgcacagagctggaaactgtcatgctggat
tggctagggaagatgattaatttgcctgaagagtttttagctgggaaagatggtcaaggt
ggaggagtcattcagggaagtgcaagtgaggccaccctcatttcactgcttgctgcaaga
acaaaaactatcagacgggtgcagttagagaagcctgagctaacagaagcagacatcatg
ggcagactggtagcctatgcttctgatcaggctcattcatcagtggaaagggctgcctta
attggtggtgtgaagatgaaaaatgtttcttcagatgatacatttagtgtttgtggttca
gccctaaagaaagttttggatgaagacaaagcttctggtcttattccattctttttctgt
gcaacacttggaaccacaccttgctgctcctttgacaaactgttagaactgggtcctatc
tgtaataaggaaaatatctggatgcatattgatgcagcctatgctgggagtgcattcatc
tgccctgaattcaggcatctgttaaacggagtggagtttgcagattcatttaactttaat
cctcacaaatggctactcgtgaattttgactgctctgctatgtgggtgaaaaaaagatca
gatttaacaggtgcctttaaattagaacctctttacctgcagcatcaccatcaggagtct
ggccttgtaacagattatcggcactggcaaatccccctgggcaggaggttccgctccctg
aagctctggttcgtactgaggatgtatggggtcacgggactgcaggatcacatccgcaag
catgtcaggctgtcacatcagtttgaacatttagtccttcaggatgaaagatttgagatc
tgtgctgaggttgtcttgggactagtctgttttcgactgaagggctcaaatgaactaaat
aaggcacttcttaaaagcataaatgaggccaagaagattcatctggtcccgtgccacctg
cgagagacgtttgtgctacgttttgctatttgttcccgcacagtggaatccacccacatc
aagtttgcctggcagcacatctcacagctggcaactgctcttctgaaaacatgggagcaa
aaccaccaccagcagttacagcagtga

DBGET integrated database retrieval system