KEGG   Athene cunicularia (burrowing owl): 113476302Help
Entry
113476302         CDS       T05777                                 

Gene name
CREM
Definition
(RefSeq) cAMP-responsive element modulator isoform X1
  KO
K09052  cAMP response element modulator
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acun00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    113476302 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acun03000]
    113476302 (CREM)
Transcription factors [BR:acun03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    113476302 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5
Motif
Other DBs
NCBI-GeneID: 113476302
NCBI-ProteinID: XP_026697524
Position
2
AA seq 346 aa AA seqDB search
MTKHAKRYRKAGVRQMTMEMVVSQQDDSAVDSVPKRDTGLLQNQPGQSQISPGSEVSVAA
SSAGRGSPAVSLVHLPSGQTVHVQGVLQAIHPSVIQSPHMQDVQVASIADESAESEGITD
SQKRREILSRRPSYRKILNELSSDAAAVPKIEEEEKSEDEGVPLGISAMPMPTSLYHTNT
GQYFTITQGGTIQISNPASDGVHGLQTVTMTNSGAPHPGATIVQYAGQSSDGTQQFFVPR
SQVVVQAATGDMPAYQIRTPTTTLPQGVVMATSPGTLHSPQQLTEEATRKRELRLMKNRE
AARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcatgccaagagatacagaaaagcaggtgtcagacagatgaccatggaaatg
gttgtatcacaacaggatgacagtgcagtggattctgtgccaaagagagatactggtctc
cttcagaatcagccaggccaaagtcagatttccccaggatctgaggtttctgtagctgca
tcaagtgctggaagaggatctccagctgtatctctagtgcatttgccttctggtcaaact
gttcatgtccagggtgtccttcaagccatacacccctcagtcattcagtcaccacacatg
caagatgttcaggtagcatcgattgcagatgaatctgcagaatcagaagggataactgat
tctcagaaacgtagggaaatactttcaagaaggccttcataccgaaaaattttgaatgaa
ctctcatcagatgctgctgcagtaccaaagattgaagaagaagaaaagtcggaagatgaa
ggagtgcctttgggaatttctgcaatgcccatgccaaccagcctctatcatactaacaca
gggcaatactttactataactcagggtggtacaatccagatttctaatccagcctctgat
ggtgtccatggactacagacagtaacaatgacaaattcaggagctcctcacccaggtgct
accattgttcaatatgcaggacaatcatctgatggcacacaacaattttttgttcccaga
agccaagttgttgttcaagctgccactggagacatgccagcttaccagattcgaaccccc
actactaccttacctcagggagtggtaatggcaacctcaccagggactttgcatagccct
cagcaattgacagaagaggcaacacgcaagagagaactgagactgatgaaaaatagggaa
gctgccagagaatgtcgcagaaagaagaaagaatatgtcaaatgtcttgaaaatcgtgtg
gctgtacttgaaaaccaaaacaagactctcattgaggaactcaaggccctcaaagatctt
tattgtcataaggcagaataa

DBGET integrated database retrieval system