KEGG   Athene cunicularia (burrowing owl): 113478615
Entry
113478615         CDS       T05777                                 

Gene name
AFF3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:acun03021]
    113478615 (AFF3)
Transcription machinery [BR:acun03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     113478615 (AFF3)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 113478615
NCBI-ProteinID: XP_026701733
Position
1
AA seq 1331 aa
MHKDAMEGRNHCGEKQTNGALCLTSLAGRRCKKKLDQIQASPSQIFIRLGIFASSFRVIE
REHYHLIAKRKYVYEPDRNVLRRKEWERRNQEAQQEDGTFNTSYSLFSEPYKTNKGDELS
NRIQNTLGNYDEMKDLLTDRSNQSHLVGVPKPGVPQTSLPKADEHLTADSRLPPPPPISS
TTSSTPAALPAQQSKSAAMGWQKAGHNAASDGQQRASKHGHRSLESHKGDFKLVNQKSSL
EKLKRYASSPTSSSSSNTTQQSSLRATLGENINRVQQPAKINCSSEGGAQAQERPAKHGG
GHCVQNFPPSLASKPSLVQQKPTAYVRPMDGQDQAPDESPKLKLPAETTKSYRGVPSNKP
DSARTKSKIAKFSIPKQEEDSGTGDNSCIEEILRMKELTETVPRDKKSTPVSTEKAVTSH
PTSPEQNGRYPRTKQKEMTHSWPPPLSAIHTPGKAEQSKFPFPNKESQQGSTGHSNTRKS
DVEPKSPEKSATHTSMLEDDLKLSSDEEENDQQAAQRSALRVLSDSLVVPQSNTRASGVS
SKGSSSSSSSESETSSESDSESESSSSESDGSKPSHYSSPEPEPPSSNKWQLDKWLNKVT
PHKAPILTHHDGPALETHPYYGRVKAERQESEKTPATGPAEHRSGEGRATASTTVGDGPR
PRTANKAPGSKGSRQKSPPAADGGPPRRAAGKKAPRRTERTSAGDGPPCPGTEEPPGSHS
FPESTAGEAPRARPGSSGTSGGCRAGHRREPRSTAAGEKRRARGPSKTAPKSKEFIETES
SSSSSSSDSGSESEREERPLPKAPAAAGAEPRAKDAGTGAANKPHGGCSAFGSINARTSS
EIAKELEEQFYTLVPFGRNELLSPLKDSDEVKSLWVNIDLALLSRIPERLPEEPLAMSAG
ANQVASLPQGSSADPPAEKGLPKSRRKRKCENEEECRDIKKTHLERESSSRLAASAHSIT
TANHCNMNENSLAIPINKNEKMLRSPVSPLSDASKHKYSNDDLTSSSRPNGSSLLPSISS
SKKHKGEIQSQPHPGDFNKAVHINSENVLLCNKPQSQTEPWSPLSSTPRDCRRTKLIFDD
MPRNADYFMQEAKRKKHKADAMVEKFGKALNYAEAALSFIECGNAMEQGPMESKSPYTMY
SETVELIRYAVRLKTHSGPNATPEDKQLAALCYRCLALLYWRMFRLKRDHAVKYSKALIE
YFKNSSKAAQNPSPWGASGKSTGTPSPMSPSPSPVSSVGSQGSTGAPSPSPIISIPQRIH
QMAANHVSITNSILHSYDYWEMADNLAKENKDFFNDLDALMGPITLHSSMEHLVQYTQQG
LHWVRNSAHLS
NT seq 3996 nt   +upstreamnt  +downstreamnt
atgcataaggatgccatggaaggcagaaatcattgtggagaaaaacagacaaatggggcg
ttgtgtctgacatctctggcagggagacgatgtaagaagaaactggatcagatacaggca
tcaccaagtcagatcttcatccgtcttggtatttttgccagcagttttagggttatagaa
agagagcattaccacttaatagcaaaaagaaaatatgtctatgagccagatagaaacgtg
ctgcgaaggaaagaatgggaaaggagaaatcaggaggcccagcaggaggatggcacgttt
aacacgagttactccctcttcagtgaaccgtacaagacgaacaagggggatgagctctca
aatcgcatccagaatacgctgggcaactatgacgaaatgaaagacttgttaactgaccgg
tcaaaccagagccaccttgttggggttccaaaacctggggttcctcagacatctctcccc
aaggctgatgaacatcttactgcagactcaagactgccgcctccccctcccatttccagc
actacttcttccacaccagcagccctacctgcccagcagagcaaaagtgctgcgatgggt
tggcagaaggccgggcacaatgctgcttcagatggccagcagagagcgagcaagcacggg
caccggtcactggagtcacacaagggtgacttcaaactggtgaaccaaaaatccagtctg
gagaaactaaaacgctatgcatcgagtcccacctcctcctcctcctccaacaccacccag
cagagctcactgagggccacactaggagaaaacattaacagagtgcagcagccagcaaaa
atcaattgcagctcagaaggaggagctcaagcacaagagaggccagcaaaacatggtggt
gggcactgcgtccaaaatttcccgccctctcttgcttcgaagcccagtctggttcagcag
aaaccaacagcttacgtaaggccaatggatggtcaagaccaggctcctgatgagtctcca
aagctgaagttaccagctgagacaaccaagtcgtataggggagtgccttctaacaagcct
gattcggccaggaccaagtcaaagatagccaagttcagcattcctaagcaagaagaggac
agtggaacaggagataacagctgcattgaagaaatattgcggatgaaagaattaaccgag
acagtgccacgggacaagaagagcacacctgtgagcaccgaaaaagctgttacttctcac
ccgacatctccagagcaaaatggaagataccccagaacaaaacagaaggagatgacccat
tcctggcctccaccactgtcagctattcacacaccaggaaaggcagaacaaagcaagttt
cccttcccaaacaaggaatctcaacagggatctacaggacacagcaatacaaggaaaagt
gatgtagagccaaagagtccagagaaaagcgcaacccatacatcaatgctagaagatgac
ctcaagttaagcagcgatgaagaagagaatgaccagcaggcagcacagagatctgctctc
cgcgttctatctgacagcctggtggtgccgcagtcgaacacccgagcctcaggagtctcc
agcaaagggtcgagcagcagcagttccagtgaatccgagaccagctcagagtctgactca
gagagtgaaagcagctccagcgagagtgacggcagcaagccctcacattactccagccca
gagcctgagccaccctcatccaacaagtggcagctggataagtggctaaataaagtcacc
ccgcacaaggcacccatcctgacccaccatgacggccccgcactggagacccatccctac
tatggtcgtgtgaaggcagagcgacaggaaagcgagaagaccccggccactggcccggct
gagcaccgcagtggggaaggccgtgccaccgccagcaccactgtcggggacggaccacgg
cccaggactgccaacaaagctccaggcagcaagggcagccgccaaaagtcaccccctgct
gctgacggcggacccccaaggcgggcagcagggaagaaggcaccgcggcggactgagagg
acctctgccggggacggccccccctgccctggcacagaggagccccccgggagccacagt
tttccagaaagcactgctggcgaggcaccgagggcccggcctggcagcagcggcaccagc
ggtggctgcagagcgggtcaccgccgggagccccgctcaactgcagctggcgagaagcgt
cgggcccgggggccaagcaaaacggcgcccaaatccaaggagttcatcgagactgagtct
tcatcctcatcatcctcctctgactcgggctctgagtcagagcgggaggagcgcccgctg
cccaaggcgccagcagcagctggggccgagccacgtgccaaggacgcagggaccggcgcc
gccaacaaaccccacggcggctgcagtgcctttggctccattaatgccaggactagtagt
gaaatagcaaaggagctggaggaacagttttacaccctggttcctttcggtaggaatgag
ctcctgtctcctctgaaagacagtgatgaggtaaagtcgctgtgggtcaacattgacttg
gctcttttgtccaggattccagagcgtttgcctgaagagccgctggccatgagcgctgga
gcaaaccaggtggccagcctcccgcagggtagtagtgctgacccccccgcagagaagggt
ttaccgaaatctagaaggaaacgcaagtgtgagaatgaggaagagtgcagagacatcaag
aagactcacttagaacgagagagttcttcacgattagctgcctctgctcacagcatcaca
acagcaaatcactgcaatatgaatgaaaatagcttggcaataccaataaataaaaatgag
aaaatgcttcggtcacccgtctctcccctctctgatgcatcaaaacacaaatactccaac
gatgatttaacttcctccagcagacctaatggcagcagtctattaccttccatctcctcc
agcaaaaaacataagggagaaatccagtcacagccacatcccggagacttcaataaagca
gttcacatcaattcagaaaatgttcttctctgcaataagccacagtcccaaacagagcct
tggtcacctctgtccagcacacccagggactgcagaaggacaaagcttatctttgatgat
atgccacgcaatgcagattactttatgcaggaagctaaacggaagaagcataaagcagat
gcaatggtggaaaagtttggaaaggcactgaattatgcagaagcagcactatcgtttatt
gagtgtggaaatgcaatggaacaaggcccaatggaatctaaatccccttatacaatgtat
tcagaaacagttgaactcatcaggtatgcagtgagactaaaaacccactcaggccccaat
gccacaccagaagacaaacagctggcagcattatgttaccgctgcctggcccttctgtac
tggaggatgttccgactcaagagagaccatgcagtcaagtattcaaaggcgcttattgag
tatttcaagaattcatcaaaagctgcccagaacccatctccttggggtgccagtggaaag
agcacaggaactccatcacccatgtctcctagcccttctccagtcagctctgtaggatcc
caagggagcacgggggctccttccccatctcctatcatcagcatcccgcagcgcattcat
cagatggctgccaaccacgtcagcatcaccaacagcatcctacacagctatgactactgg
gagatggctgacaacctggctaaggaaaacaaagatttttttaacgacttggatgcattg
atgggacctatcaccttgcacagcagtatggagcatttagttcagtacactcaacaagga
cttcactgggtgcgaaatagcgctcacttgtcataa

DBGET integrated database retrieval system