KEGG   Athene cunicularia (burrowing owl): 113479483
Entry
113479483         CDS       T05777                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00230  Purine metabolism
acun00240  Pyrimidine metabolism
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113479483 (DCK)
   00240 Pyrimidine metabolism
    113479483 (DCK)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     113479483 (DCK)
SSDB
Motif
Pfam: dNK AAA_28 AAA_18 Thymidylate_kin AAA_33 BCAS3 AAA_17 Dynamin_N
Other DBs
NCBI-GeneID: 113479483
NCBI-ProteinID: XP_026703273
Position
4
AA seq 257 aa
MATPPKRGRQEGRIKKIAVEGNIAAGKSTFVNILKQADEEWEVVPEPVARWCNVQQKSEE
DCEELTESQKSGGNVLRMMYDKPERWSFTFQSYACLSRIRAQLRFLDGKLREAENPVVFF
ERSVYSDRYIFAANLYESDCMNETEWTIYQDWHDWMNKQFGQSLALDGIIYLRATPEKCL
NRIYLRGRDEEQEIPIEYLEKLHYKHESWLQHRTLRTDFECLQGIPILTLDVNEDFKGKK
DRYDHMTEKVKEFLSTL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccactccgcccaagcgcgggcggcaggagggcaggatcaaaaagatcgcggtcgag
ggcaacatcgctgcagggaaatcaacatttgtgaatattctcaaacaagctgatgaggaa
tgggaagttgttcctgagcctgtagctagatggtgcaatgttcagcaaaagtctgaagaa
gattgtgaggagctgactgaatcacagaagagtggcggaaatgtgcttcggatgatgtat
gacaaaccagaaaggtggtctttcactttccagtcatacgcatgtctcagcaggatccgg
gctcagctcagattccttgatggcaagctcagagaggcagagaatcctgttgtcttcttt
gagcgatctgtctacagtgacagatatatctttgcagctaatttatatgagtctgattgc
atgaatgaaacggaatggactatttaccaagattggcatgactggatgaataagcagttt
ggtcaaagcctggcactggatgggatcatttatctcagagccactcctgagaaatgttta
aataggatttacttgcgtggaagagatgaagagcaagaaattcccattgagtatctggag
aagctacactacaaacatgaaagttggcttcagcacaggacactgagaacggattttgaa
tgtctacagggaatacctattttaacgttagatgttaatgaagacttcaaaggcaaaaag
gacagatatgatcacatgactgaaaaggtcaaagaatttttgagcaccttataa

DBGET integrated database retrieval system