KEGG   Athene cunicularia (burrowing owl): 113480048Help
Entry
113480048         CDS       T05777                                 

Gene name
PHF6
Definition
(RefSeq) PHD finger protein 6 isoform X1
  KO
K23310  PHD finger protein 6
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acun03000]
    113480048 (PHF6)
   03009 Ribosome biogenesis [BR:acun03009]
    113480048 (PHF6)
   03036 Chromosome and associated proteins [BR:acun03036]
    113480048 (PHF6)
Transcription factors [BR:acun03000]
 Eukaryotic type
  Zinc finger
   Cys4HisCys3 PHD fingers
    113480048 (PHF6)
Ribosome biogenesis [BR:acun03009]
 Eukaryotic type
  Other ribosome biogenesis factors
   113480048 (PHF6)
Chromosome and associated proteins [BR:acun03036]
 Eukaryotic type
  Chromatin remodeling factors
   NuRD complex
    113480048 (PHF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H zf-HC5HC2H_2
Motif
Other DBs
NCBI-GeneID: 113480048
NCBI-ProteinID: XP_026704388
Position
4
AA seq 365 aa AA seqDB search
MTSSVGQKKVSSRQRKCGFCRSNKDNECGQLLMSENQKVAAHHKCMLFSSALVSSHTDNE
SLGGFSIEDIQKEIKRGTKLMCSLCHCPGATIGCDVKTCHKTYHYYCALHDKAQIREKPS
QGIYMILCRKHKKTTHNSEADLEESINEHELEPSPPKGKRRGRKGKPRKTNLKGQSEDTR
STSSHGTDEIESSSYRDRSPHRSSPSDTKPKCGFCHAGEEENEARGKLHIFNAKKAAAHY
KCMLFSSGTVQLTTTSRAEFGDFDIKTVLQEIKRGKRMKCTLCSQPGATIGCEIKACIKT
YHYHCGVEDKAKYIENMSRGIYKLYCKNHSGNDERDEEDEERESKSRGKSGTDHNDIPQQ
QLNGN
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgacaagctcagttggacagaaaaaagtctcttcaagacaaaggaagtgtggtttttgt
agatctaataaagataatgaatgtggacaattattgatgtcagaaaaccagaaggtggca
gcacatcacaaatgtatgctgttctcgtctgcactggtatcttcacatactgataatgag
agtcttggtggattctctattgaagatattcagaaagaaataaagagaggcactaaactg
atgtgctctttatgccattgtcctggagcaaccattggctgtgatgtgaaaacatgtcac
aagacatatcactactactgtgctttgcatgataaagctcagataagagagaaaccctca
caaggcatttacatgattttatgtcgaaaacacaagaaaactacgcataactctgaagca
gatttagaagaaagtatcaatgaacacgagttggagccttcacctcccaaaggaaaaagg
aggggtcgtaagggaaagccaagaaaaacaaatttaaaagggcaatcagaagacactaga
tctacgtcctcacatggcacagatgaaatagaaagcagttcctatagagacaggtctccc
cacagaagcagccccagtgatacaaaacctaaatgtggattctgtcatgcaggtgaagaa
gaaaatgaagctagaggaaagcttcatatatttaatgccaaaaaggctgcagcacactat
aagtgcatgttgttctcttctggcactgtccagctaacaacaacttcaagggcagagttt
ggtgattttgatatcaaaactgtacttcaagaaatcaagagaggaaaaagaatgaaatgc
acactttgcagccagcctggtgctactattgggtgtgaaattaaagcctgcataaaaaca
taccattaccactgtggagtagaagacaaagctaaatacattgagaatatgtcacgagga
atttataaactctattgtaaaaaccatagtggaaacgatgaaagagatgaagaggatgaa
gaaagagaaagcaaaagccgtggcaaatcaggcactgaccataatgacattcctcagcag
cagctcaatggaaactag

DBGET integrated database retrieval system