KEGG   Athene cunicularia (burrowing owl): 113480273Help
Entry
113480273         CDS       T05777                                 

Gene name
DLST
Definition
(RefSeq) dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00020  Citrate cycle (TCA cycle)
acun00310  Lysine degradation
acun00380  Tryptophan metabolism
acun01100  Metabolic pathways
acun01200  Carbon metabolism
Module
acun_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    113480273 (DLST)
  09105 Amino acid metabolism
   00310 Lysine degradation
    113480273 (DLST)
   00380 Tryptophan metabolism
    113480273 (DLST)
Enzymes [BR:acun01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     113480273 (DLST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh
Motif
Other DBs
NCBI-GeneID: 113480273
NCBI-ProteinID: XP_026704709
Position
5
AA seq 274 aa AA seqDB search
MPPVPSVSAQPIDSKPVSAVKPAAAPAAAPPGEAVPSKGARSEHRVKMNRMRQRIAQRLK
EAQNTCAMLTTFNEIDMSNIQEMRALHKDPFLKKHNLKLGFMSAFVKAAAFALQDQPVVN
AVIDDMTKEIVYRDYVDISVAVATPRGLVVPVVRNVENMNYADIERVISELGEKARKNEL
AIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHAIVNRPVAVGGKIEVRPMMYVA
LTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgccaccagtgccatctgtgtcagctcagcctattgacagcaaaccagtgtctgcagtg
aagccggctgcagccccagcagcagcccctcctggggaggcagtgcccagcaaaggtgcc
agatcagagcacagggtgaagatgaataggatgcgtcagcgtattgctcagcggctgaaa
gaggctcagaatacttgtgccatgctgaccactttcaacgagattgatatgagcaacatc
caggagatgagagctctacacaaggatcctttcctgaagaagcacaacctgaagctaggt
ttcatgtcagcttttgtgaaagctgcagcttttgctctgcaggaccagcccgttgtgaat
gcagtgattgatgacatgaccaaagagattgtgtacagggactatgtggacatcagtgtc
gctgtagcaactccccggggtcttgtggtccctgtcgttaggaatgttgaaaacatgaac
tatgctgacatagaacgtgttatctctgagttgggggagaaggcacggaagaatgaactg
gccattgaagacatggatggtggcactttcacaatcagcaacggaggggtttttgggtca
ctctttggaacacctatcattaacccgccccagtctgccatcttgggcatgcatgccatt
gtcaacaggcctgtggctgtgggaggcaagatcgaggtgcggcccatgatgtatgtggct
ctgacgtacgatcaccggctgattgatggcagagaggcagtgactttcctgcgcaagatc
aaggcagcggtggaggatccccgcgtgctgctgctcgacctgtag

DBGET integrated database retrieval system