KEGG   Athene cunicularia (burrowing owl): 113480582Help
Entry
113480582         CDS       T05777                                 

Definition
(RefSeq) cytosolic phospholipase A2 epsilon-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00564  Glycerophospholipid metabolism
acun00565  Ether lipid metabolism
acun00590  Arachidonic acid metabolism
acun00591  Linoleic acid metabolism
acun00592  alpha-Linolenic acid metabolism
acun01100  Metabolic pathways
acun04010  MAPK signaling pathway
acun04217  Necroptosis
acun04270  Vascular smooth muscle contraction
acun04370  VEGF signaling pathway
acun04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113480582
   00565 Ether lipid metabolism
    113480582
   00590 Arachidonic acid metabolism
    113480582
   00591 Linoleic acid metabolism
    113480582
   00592 alpha-Linolenic acid metabolism
    113480582
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    113480582
   04370 VEGF signaling pathway
    113480582
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    113480582
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    113480582
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    113480582
Enzymes [BR:acun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     113480582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B cPLA2_C2 C2
Motif
Other DBs
NCBI-GeneID: 113480582
NCBI-ProteinID: XP_026705262
Position
5
AA seq 861 aa AA seqDB search
MSQEVLPVEVPEILSYMNPGKAMMLSKATAPQDEDSDINSLGDGEQKEENEGSTVPDKGD
FKIESSPCYLLTVRIIRMKNLQRVDTFSQADCYVSLWLPTATCERSRTKTVRNSNNPVWN
ETFYFRIQSQVKNVLELTVYDEDFATPDDHLLCALFDTAKLPIERTVVLYFKPNPEAKEE
LEVEFKLEIASGPHEAIATNGVLVCRELCCLEVEVTEKMQQKSKKELSLTVKGSFEGTQD
IMLGPDGVASPSGPTKFHYIKYAEPTLDVMLPKKRRYHPWTCKYTTETGSPVVMLNSLPM
GKKMTIAEEKRFDLSVRAQSCNCSCHQDLDMRFGFELCSEEMAFLGKRKRYVASALKNVF
HLQQDLQDFEVPVVAIITTGGGLKSMTGLYGSLMGLKKLNLLDCISYISGLSGTTWTMAN
LYRDAYWSQKDLDSHIGEAQKQATKCKMGCFSMDRMKYYDKQLCQRKEEGYRTSFIDLWG
LMIEYLLNDGKDPHKLSEQQEALCDGQNPLPIYVSVCVRDSYSTNDFKEWVEFTPYEVGL
LKYGAFVRTEHFGSEFFMGRLLKKLPESRICYLQGMWSSIFSVNLLQIWGLSHSSEDFWK
RWTQDRIEEVDEDPVLPTRPHELRTRMYTPPGPLSSALRGALTDRFSVAQHHNFLKGYQL
HNNYLENEHFSRWKDTVLDSRPNELMQNADHLGMIDAGFFINTSSPPLLRPQRKVDVIIY
LSYTTGSHTSTLDKAYKYYSEQKIPFPKISLTDEDRKNLKECYLFHDSDLPGCPIVIFLP
LVNDTFREYKAPGVKRCCSEMEGGQLDLTSRFSPYCMFSVRYTDENYRRLLNLSEYNILN
NSQMIMQALQIAMQRRRQNMC
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggaagtgctgcccgtggaggtgccagaaatactctcttacatgaatccaggg
aaggccatgatgctatcaaaagcaacagcaccacaggatgaagattcagacatcaattcc
ttgggagatggtgaacagaaagaagaaaacgaaggaagtactgtaccagacaaaggtgat
ttcaagatagaatcctctccctgctatctgctgactgtaaggatcatccggatgaaaaat
ctccagcgagtggacaccttcagccaggctgattgctacgtgtcattgtggctgccaact
gcgacatgtgaaaggtcccgcactaaaactgtgagaaattccaacaatccagtgtggaac
gaaaccttctacttcaggatccagagtcaggtcaagaatgtgctggagctaacagtgtat
gatgaggattttgctactccagacgaccatctcctctgcgcactctttgataccgctaaa
cttccaattgaaagaacagtggtcctgtattttaagcccaacccagaggccaaggaggag
ctagaggttgaattcaaattggagattgcttctggtcctcatgaagccattgctaccaat
ggagtcctggtgtgtcgtgaactttgctgcttggaagttgaagtgacagagaagatgcaa
caaaaatcaaagaaagagctttccctcacggtgaagggctcttttgaggggacgcaggat
atcatgttgggccccgatggagtggccagcccatcaggtcccaccaagttccactatatc
aagtatgctgagccaacgctggatgtcatgttgccaaagaagaggcgctaccacccttgg
acctgtaagtacactacagagacgggctccccggtcgtgatgctgaattcactgcccatg
ggaaagaaaatgactattgcagaggagaaaaggtttgacttgagtgtgagagcacagagc
tgtaactgttcgtgccaccaagacctggacatgcgctttgggtttgaactatgttcagag
gagatggctttcctggggaaaagaaaaagatatgtagcaagtgccctgaaaaatgttttt
cacctacaacaggatctgcaggattttgaagtccccgttgtggctatcatcacaacaggc
ggaggactgaaatcaatgacaggactgtatggcagcctcatggggctcaagaaattgaat
ctcctggactgtatatcgtacatcagcgggctgtctggcaccacttggaccatggccaac
ttatacagagatgcctactggtcacagaaggacctagactcacatattggtgaagcccag
aaacaagcaaccaaatgcaagatgggctgtttctctatggatcgcatgaagtactatgac
aagcagctttgtcagcggaaagaagagggatacaggacatcatttatagatctttggggg
ctcatgattgagtacttactaaatgatgggaaagaccctcacaaactttcagagcagcaa
gaagcactgtgtgatggccagaacccactgcccatctatgtgtcagtctgtgttcgggac
agctacagcaccaatgatttcaaagagtgggtcgagttcaccccctacgaggtgggactc
ctgaagtacggcgcgtttgttcgcacggagcatttcggaagcgagttcttcatgggacgc
ttgttgaaaaagctccccgaatcccggatctgctaccttcaaggtatgtggagcagtata
ttttctgtgaacctattacaaatatggggactgtcccacagttcagaagacttctggaag
agatggacacaagacagaatagaagaagttgatgaagacccggtgttgcctacaagaccc
cacgagctgaggactcgaatgtacactcctcctggccccctgtccagtgcccttcgggga
gcactgactgaccgcttctccgtcgcccagcaccacaatttcctgaagggctaccagctg
cataacaactacctggagaatgagcacttctctagatggaaagacactgtgttagactcg
cgtcccaatgagctgatgcaaaatgctgatcacctgggcatgatagacgctggatttttc
atcaataccagcagtccaccacttttaaggccgcagaggaaagtggatgtcatcatatat
ttaagttatactactggatcacatacatcgactctagataaggcgtacaaatactactca
gagcagaaaatcccattccctaaaatttctctgactgatgaagataggaaaaatctgaag
gagtgctacctcttccacgattcagatttgccaggatgtccgattgtgatttttcttccc
cttgtgaatgataccttccgagagtacaaggcgcctggtgtcaagcggtgttgctcagag
atggagggaggacaacttgatttgaccagtcgcttttccccctactgcatgttctcggtt
aggtataccgatgagaactaccgccggctgctgaacctcagcgaatacaacattctgaac
aactcacagatgattatgcaggcactgcagatagcgatgcaaaggagaaggcaaaacatg
tgctaa

DBGET integrated database retrieval system