KEGG   Athene cunicularia (burrowing owl): 113480630Help
Entry
113480630         CDS       T05777                                 

Gene name
ACOD1
Definition
(RefSeq) cis-aconitate decarboxylase
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    113480630 (ACOD1)
Enzymes [BR:acun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     113480630 (ACOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD DUF4971
Motif
Other DBs
NCBI-GeneID: 113480630
NCBI-ProteinID: XP_026705392
Position
1
AA seq 474 aa AA seqDB search
MWAKTVTGNFANVIHGLNANHLTDQVIQRSKRMILDTLGVGLLGTSTEVCHKVTQYSKIY
SSDISSTIWGHPNFRLPPLYAAFVNGVAVHSMDFDDTWHPATHPSGAVLPAVIALSEASP
QKKKISGLDLLLAFNVGIEVQGRLLRFSSEARNIPKRFHPPTVVGTMGSAAACAKLLALD
RLKCKNTLAIAASYAGAPLANAATQTKPLHVGNAAKHGLEAACLASQGLQGNKQILDMES
GIGAFYTDYNPQSLPTLQSYPWLLDQQDVAIKRFPAHLGTHWVADAASSVRRKLVESSDN
LLPLDKIEKIILKVPEVKYVNRPSPTSEHEARHSFQFVACSALLNGSMSVQSFTSENVHQ
PALRELLCKTQLEHPPDNTPSFDSLYCEVSVTLQDGNTISDRCDTFYGHWRKPLKKEDLE
KKFQSNASSVLPAEATEGIIETVYNLENVEDCSALSTFLSGRSARALSEKRCFL
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcaaagacagttacaggaaattttgccaatgtgattcatggtttgaatgcaaac
cacttgacagaccaagtcattcagagaagcaagcgaatgattctggatactcttggagtg
gggcttctgggtaccagcactgaggtctgccacaaagtgacacagtacagcaagatctac
agctcagacatatccagtaccatctggggacatccgaatttccgattgcctcctctgtat
gcagcatttgtgaatggagtggctgtgcattcaatggattttgacgacacatggcatcca
gccacacacccatccggggctgtgctccctgccgtgattgcactctcagaggcctctcct
cagaagaaaaaaatctcaggtctcgatctgctcttagctttcaacgtggggattgaagtg
caaggcaggctgctgcgcttctccagcgaagccaggaatattccaaaaaggtttcaccca
ccaactgtggttggtacaatggggagtgcagcagcttgtgctaaactgctagctcttgac
cggctgaaatgtaaaaacaccttggctattgctgcctcctatgcaggtgccccactggct
aacgcagccacccaaacaaagcccctccacgttggcaatgctgccaagcatggactggaa
gcagcttgcttagcatcacagggcctccaaggaaacaaacagatcttggacatggagtca
gggataggtgccttttatacagattacaacccacagagtctgccaaccttgcagtcttat
ccctggctgttggaccagcaagacgtggccatcaaacgctttcctgctcatcttggaacg
cactgggtggctgatgcagcatcttctgttaggaggaagctcgtggagagcagtgacaac
ttgctcccccttgataaaattgagaaaataattctcaaagtcccagaggtcaaatatgtg
aacagacccagccctacctcagagcatgaagctcgacactccttccagtttgttgcatgc
tctgctttgctgaatggcagcatgtcagtccagtccttcaccagcgagaacgttcaccag
ccagccttgcgggagctcctctgcaaaacacagctggagcaccctcctgataacacacct
agctttgacagtctttactgtgaagtgagtgtcacactgcaggatggcaacacgatcagt
gaccgctgcgatacgttctatggacactggaggaaacctctgaagaaggaggacttggag
aaaaagtttcaatccaatgcctccagtgtcctgcctgcagaagccacagaaggcattata
gagactgtgtacaatctggaaaatgtagaggattgttctgcattaagtacatttttatca
ggacggtcagctagagcactttcagagaagcggtgcttcctttga

DBGET integrated database retrieval system