KEGG   Athene cunicularia (burrowing owl): 113480849
Entry
113480849         CDS       T05777                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:acun01009]
    113480849 (AKAP5)
Protein phosphatases and associated proteins [BR:acun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     113480849 (AKAP5)
SSDB
Other DBs
NCBI-GeneID: 113480849
NCBI-ProteinID: XP_026705856
Position
5
AA seq 480 aa
SRKLVIQHKQRRGVNVVKAAKEIQMENSKEVETHSTGATCSPSEEQAEKPSMLCFKTRKK
PCKKGLTTKDVCEGASEEKSQCVSADQGEAKVSNQPQSSKGAWAAIKNLARPRRRQKSSS
WKKVASDSQVQLEVDAEEGCAQGFPKKRASSGVKMPCVRFSRGKKKPSPSEAVEESEGSV
QANEVMGILNKASEELEDLAPTDKSESFSPISAEEDQDTAKESADSAGKSEPLAEPTPDA
EEHMECAAQSEITDSETVNETAQEKLQEGSLPQTTVHAEGGEVAPEAPVFKEQPDSTPET
TELQEIPNISKELPEGDQPEETINLPEECKTEETVMDVSQSAFKEDAASVQGCSSHQVTL
EANAGTGISIVITVTEAEDSDNTDSDQAYEPSPVLHRNKQKGNKKSSGSFDFGKKEGPEA
CSGPQVEEKGPGDQGHRTGEQYELLLIETASSLVKAAIQSSIEQLVNEMALEQNKHNSFL
NT seq 1443 nt   +upstreamnt  +downstreamnt
tcaagaaaactggtaatacaacacaaacaaaggagaggagtgaatgtggtgaaggcagct
aaggaaattcaaatggagaactcaaaagaggtagagactcacagcacaggggcaacatgc
tccccgtcggaggaacaggccgaaaagccctccatgctctgttttaagacgcggaagaag
ccctgcaagaaggggctgaccacgaaggatgtgtgtgaaggagcctcggaggagaaaagt
caatgcgtcagcgctgaccaaggggaggcaaaagtttcaaatcagccacagtcctccaaa
ggagcctgggcagccatcaaaaaccttgcaagacctcggagaaggcagaaatcttcctcg
tggaagaaggtggcctccgattcccaagtgcagctggaggtggatgctgaggagggctgt
gctcaaggcttcccaaagaaacgggcaagctctggggtgaagatgccctgtgtgcgcttc
tccagaggcaagaaaaaacccagcccctctgaagcagtggaggagtcagagggcagtgtt
caagcaaacgaagtgatgggcattttaaataaagctagtgaagagctggaggatttggcc
ccaacagacaagtctgaatccttcagcccgatttccgcggaggaggaccaggatacagca
aaagaaagtgctgactctgctgggaagagtgagcccttggcagagcccacacctgatgca
gaggaacacatggagtgcgctgctcagtcagagataaccgactcagagacagttaatgaa
acagcccaggaaaaactgcaggaggggagcctaccccaaaccacagtccatgcggaaggc
ggggaagttgctcctgaagcacccgttttcaaggaacaacctgacagcacccctgaaacc
actgagctgcaggaaatccccaatatcagcaaagagctgcctgaaggggatcaaccagag
gagaccataaatcttcccgaggagtgcaaaaccgaagagactgtaatggatgtcagtcag
tcggcatttaaagaggatgcagcgagcgtgcagggctgctccagtcatcaggtaacatta
gaagcaaatgcaggcaccggcatcagcatcgtcatcactgtcaccgaggctgaggactct
gacaacaccgactctgaccaggcctacgagccgtccccagttttgcaccgaaataagcaa
aaagggaataaaaaatcaagtgggagctttgattttggtaaaaaagagggccctgaggct
tgttctggtccccaggtggaggagaaaggtccgggagaccaggggcacagaactggggag
cagtacgaattgctcctcatagaaacggcgtcttccctcgtgaaggcggccattcagtcg
tccatagagcagctggtcaacgaaatggccctggaacagaataaacacaacagttttctg
tga

DBGET integrated database retrieval system