KEGG   Athene cunicularia (burrowing owl): 113481213Help
Entry
113481213         CDS       T05777                                 

Gene name
PIK3C2A
Definition
(RefSeq) phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha isoform X1
  KO
K00923  phosphatidylinositol-4-phosphate 3-kinase [EC:2.7.1.154]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00562  Inositol phosphate metabolism
acun01100  Metabolic pathways
acun04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    113481213 (PIK3C2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    113481213 (PIK3C2A)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.154  phosphatidylinositol-4-phosphate 3-kinase
     113481213 (PIK3C2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_C2 PI3K_rbd PX C2 DUF4135 TraH
Motif
Other DBs
NCBI-GeneID: 113481213
NCBI-ProteinID: XP_026706462
Position
5
AA seq 1703 aa AA seqDB search
MDLCSCGMAQISSSNGFKQRSSPSLAAARSKDVDKEEALQMEAEALAKMQKERGVAGNKQ
TFHSLSSTRQKTQTHNKQDHDLMVFPESDAKSMEDKLSTIDIEKLTHAELEKLLLDDSFE
SSKVPTLPVGPILSPSVSSQFYLGPMGQRRQWMPGIPAPVTCTLPPVYPSASYTKQTGVF
QNGFHPNMSSYHSREPIYLGLPRQSQYISYPLAATTPFHPQGSLPIYPPVLTPEMAKVFD
KIASTSEFLKNGKSSTDLEMTAIKSAVSNLPASESCRDVSKFDWLDLDPLSKPKVDNVET
SNKTGDDGHGASSMTAEDPWDAVLLEEKLLVTCHLERKVNGKASGATVTRSQSLNMRTTQ
LAKLQGQTLQLQKDNGTTGMLTENVLLQEIEGQNQERSAFSQAVTKLRTKFPYTNQQANP
GFVLSPIMLQRNITGESASIKVSIEIEEFQQPVTFTCDVSSPVELIIMQALCWVHDDLSE
VDIGSYILKVCGQEEVLQNKHCIGSHEYIQNCRKWDTEIKLQLLTHSVICRDLARTEDDD
RTPIHLTKHLYKVEKPFREPIIRSSIDELLDVYHKQVNLALKNENQHKAVDHVIKTVRKI
CSALDCVETPAITESVKKLRRAVNLPRTKNAEVSLKCGDDTSNSSPVSLQPENPLKVSID
QLTKAVEALLQLHMNSCSSSSAAISAKDSKSTKEAWTATEHLQFTVFAAHGISSSWVSNY
EKYYLICSLTHNGKDLFKPVQSKKVGTYKNFFYLIKWDELIIFPIQISQLPLESVLCLTL
FGILNQSSGSSPDSNKQRKGPEILGQISLPLFDFRRLLTCGTKLLQLWTSSHPHHAPGMA
SKKGNVERIVLQIDFPSHAFDIEYKIPQAAKTTVHHSIETLEKPLRERLLAILSKDNTIG
LSKEDKEFLWEKRHYCHSHTSSLPKILVSAPHWDWASLPEIYSLLQQWPPLSPLAALELL
DSKFADQEVRNTAVNWIETLSDDELTDFLPQFVQALKYETYLDSALVKFLLARALGSIRI
AHYLYWLLKDTLYDTKFGVRYEQILGAFLSVCGKRLREELEKQTRLVQLFGMVAERVKQT
SGSARQAALQNGMERVQLFFLKNKCRLPLNPSLVAKELNIKACSFFSSNAVPLKVALINA
DPLGEEINVMFKVGEDLRQDMLALQMIKIMDKIWLQEGLDLRMVIFKCLSTGKDRGMVEL
VPASDTLRKIQVEYGVTGSFKDKPLAEWLRKYNPTEEEYEKASENFIYSCAGCCVATYVL
GICDRHNDNIMLRNTGHMFHIDFGKFLGHAQMFGSFKRDRAPFVLTSDMAYVINGGEKPT
IRFQLFVDLCCQAYNLIRKHANLFLNLLSLMLSSGLPELSSVQDLKYVQDALQPQTTDAE
ATIFFTRLIESSLGSVATKFNFFIHNLAQLRFSGLPSNDEPILSFSAKTYSLKQDGRIKQ
VSVFTYQKRYNPDKHYIYVVRVLREGQVEPTFVFRTFDEFQELHNKLGILFPLWKLPGFP
NKMVLGRTHIKDVAAKRKVELNSYIQSLMNSSSEVAECDLVYTFFHPLLRDDKVEGIDGI
ARPTDAIPSSPTSGKVGGEVKLSISYRNSTLFIMVMHIKDLVTEDGADPNPYVKTYLLPD
THKTSKRKTKISRKTRNPTFNEMLVYSGYSVETLKQRELQLSVLSAESLRENFFLGGITL
SLKDFNLSKETVNWYRLTAVPYL
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atggacctctgctcttgcggaatggcccagatatccagtagcaatggatttaaacagcgc
tcatcaccttctttggcagcagcaaggtcaaaagatgtggacaaagaggaggcattgcag
atggaagctgaggcattagctaagatgcagaaagaaagaggcgtagctggtaataaacaa
acttttcattctttaagcagtaccagacaaaaaacacagactcataacaaacaggaccat
gatctcatggtgtttccagagtctgatgccaagagcatggaagataaactaagtaccatt
gacatagagaagcttactcatgctgaactggagaaactgctgttggatgacagttttgaa
tctagtaaagtacctacattaccagtaggtcctattttgagcccatctgtgtcttcacaa
ttttatcttgggcctatgggtcagagaagacagtggatgcctgggataccagcacctgtg
acatgcactttacctcctgtttacccctcagcttcttacacaaaacagactggtgtattt
cagaatggattccatccaaatatgtcctcctatcactctagagaacctatttatcttggt
cttccaagacagtcgcaatacatttcatacccattggcagctactacacctttccatcca
caaggaagcctacctatatatcctccagtacttacaccagaaatggcaaaagtatttgac
aaaattgcaagcacctcagaatttctgaaaaatgggaagtcaagcaccgacttagaaatg
actgctataaagtctgcagtttctaacctaccagcctcggaaagctgcagggatgttagt
aaatttgattggttagatttggatcccctaagtaaaccgaaagtggataatgtagagact
tcaaataagacaggggatgatggacatggggcctcaagtatgactgccgaagatccatgg
gatgctgtgctgttagaagaaaagctgttagtaacttgtcatttggaaagaaaagttaat
gggaaggcttctggagcaacagttacaaggagccagtcattaaacatgcgaacaactcaa
cttgcgaagttacagggccaaacattacagttgcagaaagacaatgggaccactggcatg
ctgacagaaaatgtgcttctccaagaaattgaagggcagaatcaagaacggtcagctttt
tctcaagcagttacaaaattgaggaccaagtttccttacaccaaccagcaagcaaatcca
ggctttgtgctgagtccaatcatgcttcaaagaaatataactggggagagtgccagtatc
aaggtttctatagaaattgaagaattccagcaaccagtaacttttacatgtgatgtgagt
tcccccgttgagcttataataatgcaggcactttgctgggtacatgatgacttgagtgaa
gtggatattggcagctatatcctgaaagtctgtggccaagaagaagttttacagaataag
cactgcataggaagtcatgaatatattcagaactgtcggaagtgggatacagaaatcaaa
ctgcagctcttgacccatagtgtaatatgcagagatctggcacgaacagaagatgatgac
agaacacccatacatctaaccaaacacctctacaaagtagaaaagcctttcagagaacct
attataaggtcttcaatagatgagcttcttgatgtgtatcacaagcaagttaacttagct
cttaaaaatgagaaccagcataaagcagtagatcacgtaattaagactgtcagaaaaatc
tgttctgcattggattgtgtagagactcctgcaataacagaatcggtaaagaagctaagg
agggctgttaatcttccaaggactaaaaatgctgaggtatccttaaagtgtggtgatgac
actagcaacagctcacctgtttcactgcagcctgaaaaccctctgaaagtgagtatagac
cagttaacaaaagcagttgaggcccttctgcaactccacatgaattcatgtagcagcagt
tctgcagcaatttctgcaaaagacagcaagagtaccaaggaagcatggactgcaacagaa
catctccagttcacagtatttgctgcacatggaatttcttctagttgggtatcaaattat
gaaaaatactacttgatttgttctctgacccataatggaaaagatctgtttaaacctgtt
cagtcaaagaaggttggcacatacaagaacttcttctacttgattaaatgggatgaacta
ataattttccccatccagatttcacagctgcctttggaatcagtcttatgtttgactttg
tttggaatactaaatcaaagtagtgggagttctcctgactcaaataagcagagaaagggc
ccagaaattttgggtcagatttctctacctctttttgattttaggcgattgttaacttgt
gggacaaagctcttgcaactctggacttcatcacatccacatcatgcgccagggatggcc
agtaagaaaggaaatgtggaaagaatagtattgcagattgacttcccatcccatgctttt
gatattgaatataaaattcctcaagctgcaaagactactgtgcatcattccatagaaaca
ttagaaaaacctttgagagaacgtctccttgccattctctcaaaggataacactattggg
ctatcaaaagaagataaagaattcctgtgggagaagaggcattattgtcatagtcatact
agtagcctaccaaaaatactggttagtgcccctcactgggactgggcaagtcttccagaa
atatattcattacttcagcagtggcctcctttatcacccttagctgcactggaactactt
gattcaaagtttgctgatcaggaagtacgtaatacagctgtgaactggatagagacgtta
agtgatgatgagttaacagatttccttcctcagtttgtgcaggcattgaagtatgaaacc
tacctggacagtgctcttgtcaaatttcttttggctcgggcactgggaagcattcgaata
gcacactacctatattggcttcttaaggatacgctgtatgatacaaagtttggtgtaagg
tatgagcaaattcttggagcttttctttcagtctgtggaaaaaggctgagggaagagctc
gagaagcagaccagactggttcagctttttggaatggtggcagaaagagtaaagcaaaca
agtggatctgctcgtcaggctgccttgcaaaatggtatggaacgtgtgcagttatttttc
ttgaagaacaaatgccgtttgcctctcaaccccagtcttgtggcaaaagagctaaatatt
aaggcatgttcgttcttcagctccaatgcagtaccactgaaagttgcactgataaatgca
gaccctctgggagaagaaattaatgtgatgtttaaggttggagaagacttgcgacaagat
atgttggctttacagatgattaagattatggataagatctggctgcaggagggactggat
ttacgaatggttatcttcaagtgtctctcaactggaaaagacagaggcatggtagagctt
gttcctgcttcagatacacttaggaaaattcaagtggaatatggagtgacaggttctttt
aaagacaagcctctggcagaatggttgaggaagtacaatcctacagaggaggagtatgaa
aaggcttcagaaaacttcatttactcttgtgcaggatgctgtgtagctacttacgtattg
ggaatttgtgaccgccacaatgataacatcatgctccgaaacacagggcatatgtttcac
attgactttggaaaatttttgggtcatgcgcaaatgtttggtagctttaaaagggatcga
gctccttttgtgctaacatcggatatggcttatgtcattaatggtggtgaaaaaccgact
attcgctttcagttgttcgtggatctctgttgtcaagcatacaatctgataagaaaacat
gcaaatctcttccttaacctactttcattgatgctttcttctgggttaccagaactaagc
agcgttcaggacttgaagtatgtccaggatgctctccagccccaaacaacagatgctgaa
gctaccattttctttacaaggttgatcgaatccagtctgggaagtgttgccacaaagttt
aatttctttattcacaatttggctcagctgcgtttctcaggtctaccttctaatgatgaa
cccatcctctcgttttctgctaaaacatactctcttaaacaagatggccgaatcaaacaa
gtctctgtgtttacatatcagaagagatataacccagacaaacattatatctatgtagtg
agagttttgagagaagggcaagttgagccaacgtttgtcttccgaacatttgatgagttc
caggagctccacaacaaacttggcattctctttcctctttggaagttaccaggctttcct
aataagatggttctgggaagaacacatataaaagatgtagcagctaaaagaaaagtggag
ctcaacagctacatacagagtctgatgaacagttcttcagaggtggcagaatgtgatctt
gtttatacttttttccatccattacttcgtgatgacaaagtggaaggaatagatggaata
gccagacctacagatgcaattccatcaagtcctacctcaggcaaagtgggaggagaagtg
aaactatccatatcatatagaaatagcactctctttatcatggtgatgcacattaaagac
ctggttacagaagatggtgcagatccaaatccctatgtgaaaacttacttacttccagat
acgcacaaaacatccaagcgcaaaaccaaaatctcccggaagacaagaaatccaactttc
aatgaaatgcttgtgtacagtggatatagcgtggagactctgaaacagagagaacttcag
ctaagtgtgctcagtgcagaatcgttacgtgagaactttttcttgggtggaattacactc
tcactaaaggacttcaacttgagcaaggagactgttaactggtatcgcctaactgctgta
ccttatctgtga

DBGET integrated database retrieval system