KEGG   Athene cunicularia (burrowing owl): 113481831Help
Entry
113481831         CDS       T05777                                 

Gene name
MINPP1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00010  Glycolysis / Gluconeogenesis
acun00562  Inositol phosphate metabolism
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113481831 (MINPP1)
   00562 Inositol phosphate metabolism
    113481831 (MINPP1)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113481831 (MINPP1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113481831 (MINPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DUF4708
Motif
Other DBs
NCBI-GeneID: 113481831
NCBI-ProteinID: XP_026707571
Position
6
AA seq 225 aa AA seqDB search
MLCRQRCQRDVRIITNLVQVAFLTCSYELAIKNVTSPWCSLFSEEDAKVLEYLNDLKQYW
KRGYGYDINSRSSCILFQDIFQHLDKAVEESKSSKPISSPLIVQVGHAETLQPLLALMGF
FKDDEPLKANNYVRQAHRKFRSGRIVPYAANLVFVLYHCDQVKTSKEEYQVQMLLNEKPM
LFHHSNETTSTYADLKDYYKDILENCHFKEECELPKVNVTAVDEL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgccgccagcgatgccagcgggatgtgaggattataaccaatcttgttcaagtg
gcttttctcacatgctcttatgagttggctataaaaaatgtgacttccccatggtgttca
ctcttcagtgaagaagatgccaaggtactggaatacctgaatgacctgaagcaatactgg
aagagaggatatggctatgacatcaacagtcgctctagctgcattttattccaagatatc
ttccagcatttggacaaagcagtggaagagagcaaaagttcaaaacccatttcttcacct
ttgattgtacaagttggacatgcagagactcttcagccactgcttgcccttatgggtttc
ttcaaagatgatgagcctctcaaggcaaacaattacgtcagacaagcgcatcggaaattt
cgcagcggccggattgtgccttatgcagccaatctggtatttgtgctttaccactgcgat
caagtgaaaacctctaaagaagagtatcaagtgcagatgctgttgaatgaaaaaccgatg
ttgtttcatcactcaaatgagaccacctctacttacgcagacctcaaggactattacaag
gacatcctggaaaactgccatttcaaagaagagtgtgaattaccaaaagttaatgttact
gctgttgatgaactttga

DBGET integrated database retrieval system