KEGG   Athene cunicularia (burrowing owl): 113482096Help
Entry
113482096         CDS       T05777                                 

Gene name
TTN
Definition
(RefSeq) LOW QUALITY PROTEIN: titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113482096 (TTN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:acun04131]
    113482096 (TTN)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:acun04812]
    113482096 (TTN)
   04147 Exosome [BR:acun04147]
    113482096 (TTN)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     113482096 (TTN)
Protein kinases [BR:acun01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   113482096 (TTN)
Membrane trafficking [BR:acun04131]
 Others
  Actin-binding proteins
   Others
    113482096 (TTN)
Cytoskeleton proteins [BR:acun04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     113482096 (TTN)
Exosome [BR:acun04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113482096 (TTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 fn3_2 Receptor_2B4 Ig_6 C1-set Pkinase Tissue_fac Titin_Z Ig_5 Pkinase_Tyr Ig_C17orf99 Izumo-Ig Ig_4 THB PPAK Kelch_1
Motif
Other DBs
NCBI-GeneID: 113482096
NCBI-ProteinID: XP_026708229
Position
7
AA seq 34531 aa AA seqDB search
MTTKAPTFTQPLQSVVALEGSAATFEAHISGFPVPEVSWYRDGQVLSAATLPGVQISFSD
GRAKLVIPTVTEANSGRYTVQATNGSGQATSTAELLVTAGTAPPNFAQRLQSMTARQGSQ
VRLDVRVTGIPTPVVKFYRDGVEIQSSPDFQILQEGDLYSLIIAEAYPEDSGTYSVNATN
NVGRATSTAELLIQGEEEAVPAKKTKTIVSTAQISQTRQARIEKKTEAHFDARSLTSVEM
VIEGVTAQQLPHKAPPRMPPRPTSKSPTPPIIAAKAQMARQQSPSPVRQSPSPVRHVRAP
TPSPVRSVSPAGRISTSPIRPVKSPSPIRKTHVVTTGGAEVLPPWKQEGYTATTEAQMKE
TRVSTSATQIRTEERWEGRYGVQEQVTVSGATAGEVAAGAREVKKDSEKTAAVATVVAAV
DQAMVREPPPGVVEQTSKRTAMTAVHVQPVREQMRKEATVVVTSDKATKQTVISRTREGI
VTSQEQRHISHEKIQKEPEKTPLPTAIIATDKAKEQERISRAREEVSTRHEQVHIAHEKI
RKEDIKPSVPKVVITADKPKAPVIISKSKEGIATKQEQVSITHEKIKKEAKKTTVVPKII
ATDKTKAPITVSRTREEITAKQEQIHLTYDQTEAGKRAEAVATVVAAVDQARVRSPWEPE
QADEAYVKQKTLAYGYKEHAVTDHAAEAPAERHVVTKEVKTVYVPPEKHIAATEKKEIQL
STEIKRATETEKTIHIEHPRPRTASPHFTVSKIAVPKPDHTYEVSIAGSAMATLEKELSA
TTAAQKITKPVKPPQLKPHEVRIKAEPAAPPQFPFGEAAEAYKSRYDVETRKEAGVSIKG
EAVWEEHLVSRKEGEAKVTETARVPVPAEIPATPPTLVSGLKNKTVTEGESVTLECHISG
HPQPTVTWYREDYKIESSMDFQITFKAGLARLVIREAFAEDSGRFTCTATNKAGSVSTSC
QLYVKVSEEIETRETISEKAVKEEKRYVETKDIVMEDVSAAAEEVSGEPIPPFFIRKPIV
HKLIEGGSIIFECQVGGNPKPHVYWKKGGVPLTTGYRYKVSYKRETGECKLEISMTFADD
AGEYTIVVRNKHGEASATVSLLEEADYDAYVKSQQEMMYQTQVTAYVQEPKVAEVAPAIS
YGDFEKEYEKEQALIRKKMAKDTVMVRTFVEDEEFHISSFEERLIKEIELRIIKTTLDEL
LEEDGEEMMVDISESEAIEAGFDLRLKNYRTFEGTGVTFHCKTTGYPLPKIAWYKDGKRI
RHGEHYHMEVLQDGSASLRLPVVLPEDEGIYTVFASNMKGNAICSAKLYVEPVAPTATPG
YMPGPEVMRRYRSLSPRSPSRSPARSSPSRSPARRLEETDEGQLERLYKPVFVLKPTSFK
CSQGQTARFDLKVVGRPMPETYWFHNGQQVVNDYTHKIVIKEDGTQSLIIVPAMPDDSGE
WAVIAQNRAGKASVSMTLSVEAKEDLVRPHFVERLKNVSVKEGSRLEMAVRATGNPNPDI
VWLKNSDIIVPHKYPKIKIEGTKGTAALKIESTARQDAAWYTATAINKAGRDTTRCKVNV
EVEHAEPEPERRLIIPKGTYKAKEIAAPELEPLHLRYGQEQWEEGDLYDKEKQQKPFFKK
KLTSLRLKQFGPAHFECRLTPIGDPTMVVEWLHDGKPLEAANRLRMINEFGYCSLDYGVA
YSRDSGVITCRATNKYGTDHTSATLIVKDEKSLVEESQLPEGRRGLQRIEELERMAHEGA
LPAVAVDQKEKQKPEIVLVPEPARVLEGETARFRCRVTGYPLPKVNWYLNGQLIRKSKRF
RLRYDGIYYLDIVDCKSYDTGEVRVTAENPEGFIEHKVKLEIQQREDFRSVLRRAPEPKH
EPVVTEPGKLLFEVQKVDKPAEATTKEVVKLKRAERITHEKLSEESEELRSKFKRRTEEG
YYEAITAVELKSRKKDESYEEMLKKTKEELLHWTKEIPEEEKKALPPEGKITIPTFKPEK
VELSPSMEAPKIFERIQSQTVAQGTDAHFRVRVVGKPDPECQWFKNGVQIERTDRVYWYW
PEDNVCELVIRDVTSDDSASIMVKAFNIAGETSSHAFLLVQAKQLISFTQKLQDIVAKER
DSMATFECETSEPFVKVKWFKDGIEIYSGEKYRMHSDRKAHFLSVLAVEMSDADDYSCAL
VEDESIKTTAKLTVEGAVVEFIKELEDVEVPESFSGELECEVSPEDVEGKWYHGDVELTS
NHKYVIASRRGRQILTIKDVNKDDQGEYSFVVDGKRTRCKLKMKPRPMAILQGLTDQKVC
EGDIVQLEVKVSLENVEAVWMKDGHEIQSSDRIHIVLDKQSHMLLIEDATKEDSGTYSFN
VPGLGLSTTGRITVYSVEIVVPLKDVHVVEGTKAILECKVSAPDVSSSKWYLNDHQIKPD
ERVQAVCKGTKQRLVLTRTHASDEGRYKLMVGKAETSCNVTVEKIQIIRGLHDITCTETQ
NVSFEVELSHSGIDVIWQFKGQEIKAGPKYKIEARGKIHKLTVVKMMKDDEGEYVFYAGE
KKTSGKLIVAGGAISKPLTDLTVAESQAAVFECEVANPESDGQWLKNGRPLPMTDQYRSE
SDGVKRRLNIPVTKLDDMGEYSYQIASSKTSAKLKVEAVKIKKTLKNLTVTETQEAVFTV
ELTHPDVKGALWIKNGVELESNDKYDISVKGTVHTLKIKHCVVTDESVYSFKLGKIGANA
RLHVETVKIIKKPKDVTALENAVVSFELSVSHDTVPVRWFHKNVELKQSDKYKMISQRKV
HKLMLHNISPADAGEYTALVGQIECKAKLFVETIHITKTMKNIEIPETKTASFQCEVSHF
NVPAVWLKNGVEIEMSEKFKIVVQGKLHQLNIMNTSSEDSAEYTFVCGNDRVSATLTVKP
ILITSMLKDINAEEKDTITFEVTVNYEGISYKWLKNGVEIKSTDKCQIRTKKLTHSLSIR
NVHFGDAAEYTFVAGKAASSATLYVEARHIEFRKHIKDIKVVEKKRAIFECEISEPDIHV
QWMKDGQELQIGDRMKIQREKYVHRLIIPSTRMSDAGQYTVVAGGNTSSANLIVEGRDIR
IRTVRKDIQVIERQRAEIEFEVNEDDIEPQWYKDGIEINFQYEERYSYVVERRVHRMSIF
ETTYSDAGEYTFVAGRNRSSVVLYVNAPEPPQIIQELEPTTVESGKPARFCAMISGKPQP
KISWYKDDQQLSPGFKCKFLHDAQEYTLLLIETFPEDAAVYTCEAKNDYGVATTSASLSV
EIPEVVSPELEVPVYPPAVIIPLRDAVTSEGQSACFQCRVTGTDLKVSWYSKEREIKPSR
FFRMTQFEDTYQLEIAEAYPEDEGIYTFVASNSVGQVTSTATLKLEAPEKIIHEKLEEEI
EMEVKDIASSLIVSSEEGRSEGYSSGFQLPDREKTLEFEPEKPVYSSNAKMKMEEGGKAP
FFLKRVSDVEVWQGDVARLSVTVTGSPTPKIHWFFNRMKLTPSTDCKLVFAGNDHSLILP
YAGVQNEGEYRCVASNVHGEITCSAHLHVRQRIPGVPYFAREPDSVRCAPGFTAVFEYTV
AGEPCPDVQWFKGTEQLFSDARRSVAHHPDGTGSLTVWECMEEDTGLYMCRAVSTLGEAT
CSAELLVLPEEHAVCRQNPVLQHSAVAEDQSPFSYEEAVELPAMEGALSLEAMRESPALV
QLQTSQVEHVLRREDILPGLPPACLAAQSVEEMLAQVATTHESSRLLAEPLQTLPDGPQG
VVPAAAMETQLPGCLGIVAAQILLPKEEVIPKAAEQMATLKTETSQALLQVSSSTDSCAI
DGDHIQVLEGLQAMQSELKAEPRFPSELAITGGQAVPLEHISSLKAAEEDFAARICEGQA
VRFPLLLEENQPLEEEHVINLASPLRQYPRAGRQPHEKMYSHQLQPSQVLNKESQLTAQF
PKSYNLDIKSQARNALKAAVVSEQNLLFSEWLADKENIEVQTINITKEQNHTLCTYVVTT
GGLSPTEISVSLGEVSIQTVDQKTVLKEAFCSLICEEKHLLTGEKSKALPVHPSPLLSGE
SCDEASKLEPQQAERTIEAEIPLEQPLSAQIINTVTRHGQIKDVGAAAATADVASTGVPI
ETPTEILKRKENREEMCEEEERESLEELEDELGKEGCPIIHTKLVNTVVEEGESVSLVSV
ITNAREVNWYFEGKLVSSGGKFKCLQDQDTYMLVISKACEEIHQGEYTCVALNQGGKRAT
AAKLTVVKRVAPILRRRLESLEVAVNHVAKFTCEVETAPNVRFQWYKAGREIYDGDKYSI
RTSNYFSTLEIPRPQVVDCGEYSCKASNQHGSVSSTALLTVTEALPPTFLTRPESITTFV
GKSAKFLCTVSGTPVIDVAWQKDGTTISPSDHHKISKVENKHMLEISCLTTSDRGVYTCK
ASNKFGADICQAEMVIIDKPHFIKVLQSVQSAVNKKIHLECQVDEDRKVTVGWTKDGNKI
PPGKDYKIYFEDKIASLEIPLAKLKDSGHYVCTASNEAGSSSSSASITVREPPSFVKKID
PSYLLTPGDSARLQCKIKGSPEIQVTWFKNNKEIRESNTHRMSFVNSVAVLDILEMKVDD
SGSYSCEAVNEVGSDSCATEVVVKEPPSFIRTLEPAEVVKGTNTVLQCEVAGTGPFEISW
YKDKKQIRSSKKYRLTSQKAVISLEVSSFNSADVGEYECMIANEVGKCVCSATYILKEPP
SFVKKIENVTALSGDSITLQAVVKGSEPISVMWMKGKDIIQDDNKVRVTFEHGLATLQIT
GVQLSSGGKYTCVAENDAGSQSCFGELAVKEPAKIIEKSEMIQVTAGEPAILEYTVTGTP
ELKTKWFKDGRPLPASKKYRISFKNNIAQLKFYATEMQDSGEYTFEISNDVGISSCTTSF
TVLDRTLPPFFTKPLKNIDSIISTSCRLDCKISGSLPMTVSWFKQDTEITSSAKYTVHFA
EGSASLEIKHLDPSDAGVYICRATNSAGSKESSSTLFIKEPPSFTVEPESQDVLPASTVR
FKGTFKGTTPLTVKWFKGDTELVTGGACYIMTEALASYLELYAVKPTDSGRYTCKVSNVA
GSVTCSANLFVKEPAAFKEKLEPTHLVKKGGYAELTCEVTGTPEIKITWFKDDRELKESD
KYRMSFAKSLATLHVTEVETEDSGEYICEVKNDAGKDICSSVVTIKESPYFSKEFQSMEV
LKDSDVVLECEVLGTPPFEVFWVKDDKPVRSSKKHRISIEKSLISLHVFRFDASDVGEYQ
CRVTNDVGSCLCSSEVTLKEPPQFLKRIENISSLRGGTVVFQAAIKGSLPITVSWLKDND
EVIEDNNIKMTFVNNVATLLVRSIELKHDGKYFCQAKNEAGIQRCSALLTVKEPATIVDK
AVSIDVTEGDPATLQCKFSGTKHITAKWFKDGKELTLGPKYKISVTDTVSVLKVLHTEKK
DSGEYIFEVHNDVGSTSCAASINVLDLIIPPKFTKKLKKMDSIKGSFVHLECIVSGSHPI
SIQWYKDDQEITASEKHKYSFHDNTAFLEINKLEGTDSGSYTCEATNKAGSNQCSGLLTV
KEPPYFVEKPQSQEVVPNARVQFKALVKGSTPLQIKWFKDSQELLSGANRSVWKDNTSSV
LELFSARTSDSGNYTCQISNDVGTATCKTVLFVKEPPRFIQMPTSVVALREGQSTTFECQ
VVGTPEIHVTWYLDGNEVTDQAKYGVSFIDGLATLKVTQARVSDSGIYVCEAHNDAGSES
CSVELKVKEPPTFIRELSPTEVVKGLEATLECEVTGTPPFEVKWLKNNKEMFSSKKYAIS
TKESVFTLNVSNCDVSDVGEYQCIISNEGGSCSCSTRLSLKEPPSFIKKLENVTSILKGT
ALFQCVVAGAQPLSVSWIKDEKILEEDVHHHITFENSVATLKLTNVDLSHRGRYTCQAKN
ESGVEKCFALLFVQEPARIIEKAKSLKVTERDPVTLECTVAGTPELRIRWYKDGKQLLPS
RYYTMSFENNVASFRIEPVSKEDSGTYSFKVENDFGSSTCEAVLTVLDQSIPPAFIKKLT
KKDTILGSSIQMECKVSGSLPITAKWFKDGKEITDSAKYRSLCHENTMSLEIANLELADS
ANYTCSVSNVAGNDSCSAVLTVKEPPSFLIKPESQQAIPDSTVEFKATLKGTPPFTVKWF
KEDLELVSGPTCFIGIEGSTGFLTLYSVDTSKSGHYTCHVSNDVGSDSCTTTLMVTEPPK
FAKKLEAAKVVKQGDSARLECKVSGSPEMKVVWFRNDHEIVASEKFRTSFIDSVAVLEMN
HLSTDESGDYICEAHNPAGKASCSTKVTVKEPPVFSRKPSPVDMLKGTEVNLECEISGTP
PFDVIWYKDRRQIRSSKKYKVTAKNYHTSVRILNVEAADVGEYQCKAQNDVGSDTCFCTV
KLKEPPKFLTKINSVTVVVGEPVELQARVEGSQPISVQWLKDKEEIIRESENTKITFMEN
IATLQLVRTETSNAGKYICQIRNDAGSRECMATLTILEPAVIVEKAEPMRVTVGDACTLE
CKVAGTPELSTGWFKDGKELTSNQKYRITFLNKVSTLKIMDAEKEDGGLYTFAVQNDVGK
SSCTASVDVLDRIIPPSFTRKLKETPCVLGSSALLECKVSGSPPISVAWFRNGLKLVNGE
KHQISFSDNLCILEVNSLSDSDTGTYTCKATNIAGSDECSAVLTVQEPPSFERTPEPLDV
LPGTSITFTCVIRGTPPFKVNWFRGANELVPGDKCNIYLEESMVELELFDVTPLQSGEYT
CLVTNDAGRANCTAHLTVKEPAVFVKKLSDQYVEPGKPIILEGTYTGSLPISVTWKKNGH
TITQSQKCSITTTEKSCILEILDSTKEDAGEYTCHVENEAGKDVCEAVVSTLEPPYFVTH
LEPLEVSVGDYTTLQCHIAGTPEITVSWYKGDTKLRSTPEYKVFFKDNVATLIFNKVASN
DSGEYICKAENSVGTASTKALLKVQERKRPPSFARKLKDIEHPLGLPLKFMCRLNGSEPI
TVTWHKDGVLLSDDHNVHTSFVDNVAVLQLGRTEMNHTGQYSCTATNAVGTATSSARLTV
AEPKQAPVFDTKLESIDVPFGESADFECHVTGTQPIHITWSKDGREIRTGGNFNITFVAN
TVHLRVLRVGKGDSGQYTCQASNEAGKDFCSAQLSVKEPPKFVKKPEALRFVKQGDTVQL
ECKISGTPEIRTVWYKNDQALQASNRLHMSFVDSVAMLTILGATSEDAGDYICEAHNSAG
TASCSSSVTVKEPPVFIKVPSPVDTLKGSDVILQCEIAGTPPFEVAWFKDRRQVRSSKKF
KVTAKNSIASLHILNLESQDTGEYQCKAMNEVGSDTCTCPVKFKEPPRFAKKLSDTAIFV
GEPTALQAVVEGSPPISVVWLKDKGEVIRESENVQMWFMDNIATLEIASAEGADVGKYIC
QIKNDAGMRECSAFLQVLEPAVILEKTEPITVMAGNPFTLECKVGGTPELITKWYKDGRE
LRNDRKYQITFFNNISTLKVFSADRGDRGLYTFEVHNEVGDSSCTSSVDVSDRLVPPSFS
RKLKETNGVLGSSVLLECKVSGTSPISVAWFQDGNEIVSGEKYEISFLDNVCALKLNALD
VTDTGPYTCVAANVAGSDECSAFLTVQEPPSFVKTPDPQEVLPRSSVTFTSYIKGSTPFK
VTWFRGIRELVPDSNCSISLDESVAQLQLYNVEPGHSGDYACVVTNDAGSASCTTQLFVK
EPAVFVKKLSDFSVEQGKSIVLESSYTGTPPISVTWKRNGMPIAQSPRCSVTTTDKCGIL
EIFNSTKSDEGEYTCEVANEAGGDVCHSLVSILEPPYFVTHLDRVEVKVGEPLVLKCQIG
GAPEIKVSWYKDDTKLRSTQAYKMHLKNNVATLAFSTVEDSDIGEYICKAENSVGFATST
ALLVVKERQLPPTFTRKLKDIQEAVGAPVTFDCRINGSEPIQVSWYKDGVLLSDSDNMQS
AFLNNIATLQILQTSMAHCGQYTCSAQNALGTASSSAKLVLTEHLQPPFFDIKPVPINVA
RGESATFKCHMTGSAPMRITWTRDNREIRPGGNYKMTLVENTASLTVLNVGKGDAGLYTC
TASNSVGKDACAAQLAVQEPPRFIKKLDSSRLVKQHDSTKYECKIGGSPEIKVTWYKGDT
KIHPSEKYRMSFVDSVAAIEMHNLSVEDSGDYTCEAQNPAGSASTSTSLKVKAPPIFTKK
PHPVQTLKGSDIHLECELQGTPPFQISWYKDKREIRSSKKYKVMSENYLASIHILSVDTG
DVGEYHCKAVNDVGSDSCIGSVTLRAPPSFVKKLSDLTVVVGESIELQAAVEGSQPISVL
WLKDKGEIIRESENLWISYSENIATMRIGNAEPANAGKYVCQIKNDAGVKECFATLTVLE
PAVIVEKPGPVKVTAGDSCTLECAVDGTPELTARWFKDGNELSTDHKYKISFFNKVSGLK
ILNARLEDSGEYTFEVKNSVGKSSCTASVHVSDRIIPPSFTRKLKETYGQLGSSAVLECK
VYGSPPILVSWFHDGQEITSGDKYQATLTDNTCSLKVNRLQESDMGTYLCTASNVAGSDE
CSAFLSVREPPSFVKKLEPLNVLSGENITFTSIVKGSPPLEVKWFRGSVELVPGERCNIT
LQDSIAELELFDVHPLQSGDYTCQVSNEAGKISCTAHLFVKEPAKFVKKVNDLNVEKGKN
LILECTYTGTPPISVTWKKNGVKIMHSEKCNITTTETSAILEISSSKLEDQGQYSCHIEN
DSGQDNCHGAITVLEPPYFITPLEPVQVTVGDSASLQCQVAGTPEMIVSWYKGDTKLRGT
ATVKMHYKNQVATLVFSQVDSSDSGEYICKVENAVGEAASSSLLTVQERKLPPSFTRKLR
DVHETVGLPVTFDCGIAGSEPIEVTWFKDGVHLKEDYNVHTSFVDNVATLRILKTDRSLI
GQYTCTATNAIGTASSSGRLVLTEGKTPPFFDIPITPVDGIIGESADFECHISGTQPIRV
TWAKDNQEIRTGRNYQISYVDNTAHLTILSVDRGDSGKYTCYASNEAGKDSCTAQLNVKE
RKTPPTFTKKLSEAVEETEGNELKLEGRISGSQPLTVAWYKNNQEVHSSPHCEISFKNNT
LLLHIKSVEQSDAGLYTCKVSNEAGSVLCTSSVVIREPKKPPVFDQPLQPTAAAEEGDTL
HLSCHVQGSQPIRIQWLKAGREIRASDRCNFSFANGVALLELAAVIKSDSGEYVCKASNA
AGSDTCKSKVTIKEKPSAAPAAKKVEVEGKLYFVTEPQNIKVMEKTVAKFIAKVGGDPIP
NVKWMKGKWRQLNQGGRIIIQQRGDEAKLEIKDAIKTDSGMYKCVAFNQHGEIERSVNLQ
VEERKKEEVVEGDLRAKLKSTPTKKKEEEEQPIDILELLKNVDPKEYEKYARMYGITDFR
GLLQAFELLKQTQAEESHRLEIELTEKAQREDQEFDELVAFIQQRLSQTEPITLIRDIEN
QTVLTDEDAIFECEIKINYPEIKLSWYKGTQKLDSNDKYEIRIEGDHHILRIRNCQLEDQ
GNFRIVCGPHIASARLTVIEPAVERHLHDTTFKEGNICTLSCQFSIPNAKSQWYRNGRPI
KIGGRYSTQVSDKVHKLIIKDVRTEDQGQYTCRLDNLETTADLAIEAEPIQFTKSIQNIV
VSEHQSATFECEVSFDDAVVTWYKGPTELRESPKYSFRSEGRCHYMTIHNVTAEDEGVYS
VIARLEPRGEARSTAELYLVTKEIKLELKPPDVPDAKVAVPPQKPAEAAPIPILLPLVPP
PVEKKPAEKKVPVKKVSKKVVKKGPEEVPPPKVPEVLPEKPKEIKITSMARREEIYEEKK
EIYEKPKEIYEEWEEDYGEDHDYYVKEEGYDEGEEEWEEAYEKREVSYEEKRVIHEEVVE
VPKKPVPERKPPTITAEKKEKKEVTVRKVVKKPVDEKVEITTQRVGEEKVKRAEVTKKVV
PPKPTPMIIEEKVVKKEVPTVETWTVSEEKMSVSVHREEEYSYVTEPTEHEKTVEERFFE
AVYPIEAHKEVEEEEEEEEEEEEISTEVEIPHTEVPEIPKRHIPEERKPVPVPKKEAPPA
KVPEVPKKPVPEKKVAVAKKEVAPPAKVPEVPKRAPPEKKIAVPKREEAPAPKVPEVPMK
PAPEEKIPHVPKVEAPPAKVPAVPKKPIPKEKVPPAVPKKVEAPPAKVPEVHKKATFEER
VLITEERISVAIPEEIPPPEEPTVEEWAEEEIEESSISIHREEVSEVTEEESYYIEERVT
VPKREEAPPTKVPEKHRRVVPERKVPAAPKEAPAVKVPEVHKKAVPKEKVPVPVTKKLEA
PQAREPAEERVPTFEIEVEEPPSTRVTEVHRKIITEEKVAVAKKEEAPPKRAVPKKPVPE
EKVPVPISQKVAAPPPKVPEAPKKIARQERVSIAVPKRKVSPPPEVPTEEEHWAMSEEVS
ISLHTEKEISYTVPDVPERAIIEERVPVYPPKKMARPPAKVPEMRKTVVRKEKVYVEVPQ
YEEEEEIPTYEEEEATRYEEEVIHYKEEVHHYEEVSHYEEEVPQYEEVPQYEEEEVTHYE
EAAAYYEEVPEYEEEEPEVPQYEEEAPPRVRVPEVPKKPVPEEKIPILKKKEAPPAKVPE
VLKKPVPEEKIPVPVPKKKEVPPAKVPEVPKKLVPEEKVLVPVPKKVEEPPPAKVPEVPK
KVPEKKVPVPVYKKPEPPPAKVPEVPKRAVPQEKVPVAVPKVKKIPPAKVPEVTKKVVPE
EKVPIFAPEEEEEATIPEEIIPAKVPEIPKKPISKEKIPVPTPEKMELPPAKVPEMPKKL
VPEEKEPVPKKVPAPPAKVPKMPKKVVPEEKVPVAEKVEVPAAKVPEVRKRAVAEVKVPA
VVPKPKEPTPTKVSEVSKKLVRKEKVPAPAPVVEKYEYAYEEYEKYETYESIGEFEKVQE
TEEIEAYEEPEEPERYKEIQEQEYEEEAEEKEDFYEKYEFKEKEEICEKYEEVYEETYEI
QPAIVPKVPKRPVPEEKVPVPVLKKEAPPAKVPKKPVPKEKAPSAVPKKEMPPPAKGPAV
PIRTVPEEKKPTYAPEIEVPPMKVPEFHKRAVLEEEVFTIISREEEPRLYEDVMCLSLLF
VAYILYIVMFFKKYNIFEVPAVPKKTVPPKKIPAAVPTEEAPPAKVSEVPKKAVRKEKIP
PALPKEEASHLKVPTVIKKAVPEEKVPTTVPKKTEPTPVPKRPESPPSKVPELPKKTIPE
EKPVPLPKKPEAPPAKVPEVPKKIPEEKVPIAVPRKPAPPAAKVPEAPKEVVVEEKIKVA
VPKKPEVPPAKVPEVPKKVPDEKILVAEPKKPAVPPPKVPEVPKKVVPEEVSVKVPKKPE
PPPTKVPEEPKKVVSEEKIHVAVPKKAEPPPPKEPEMPKKVVPEKKIPVPKIPEPEVVPK
EQEPVVVPEPEAAPEEPEPLPEKVAKTTLPEKKVAVPVSQKRKHTAEPSKPKPQEVEPQE
LEPTRVARKQKPVTAPQKLEHVVASEEPETVLASQKPERVVVPEKPESIVVPEEPKPDVA
SQKIKHSVVSPKQKPVVEPQKPMHVVVPEKPEFVVVPEEPKLDVPPQKLKYGVMPSKQKP
VVEPQKPMRVVVPEKPEFVVVPEEPKLDVPPQKLKYGVMPSKQKPVVEPQKTEPFMASEE
PELTVAPEESEEVALTQKSEYVVVPPKTKPFVPPQKTEFVVAHEETEFVADFQKSVRIAV
SRKSKPAVASCKPEPFTVPEEPEPILAPQKLQPSRVLQKPKPEVASEEPEPVLPPEEPPP
AELAKKQESVAIPKKRAAPRSKEPSMPEKAVPEEKIHVALPEKPEPPSVRVPTKLKYTNI
FEVPKVPKKSVLEEPIPVTVPKKPEPAPVRAPEVPRKATREEKVPVAIAKAPELPAPRVP
EMPEAEVPEEEEEEEAPPEMTPVAEPVEPEAPPAEVPEVAEEEELEEEVPAIIPPKPVAV
PKKAVAVPKKPEAPPAKVLKVPKKAVLQEKTPVAAPKKPELPLAKVPKEPRKSVLEEPIP
VTVPKKPEPAPVRAPEVPRKATREEKVPVAIAKAPELPAPRVPEMPEAEVPEEEEEEEAP
PEMTPVAEPVEPEAPPAEVPEVAEEEELEEEVPAVIPPKPVAVPKKAVAVPKKPAVVPKK
PEPVTVPKIPEPVPVLKKHKVPSVKVPEVPKKPVPEEKVPVAVPKIPEPLPSEEYEIVKE
IEPEEAEEIPAAKIEEALPAEAPEPEKKIPEKRKPPPLTAPTEDIKLAKELLKAPGSRKK
VVTAKPGEPPELEPPPAKVPGLVKKPRRVIPEVAPPPKEEVVLKRVLKKKTEEEEPKPEK
EPKPEVKPVPTPAEKIKKPEVPEVPKKKTEIPVIKKEEKYVPEPPKEPKQAAIPLPGPEP
KPAVALKSPKPAAEPAPAVTTPVTVPVVGKKAEPKPPKEESPKGISPVKGRIXKTPSPAD
AERRKLRPGSGGEKPPEEPPFTYQLKAVPLKFVKEMKDIVLTEAESVGSSAIFEVLISPS
TAITSWMKDGSNIRESPKHKFIADGKDRKLHIIDVQLSDAGEYTCVLRLGNKEKTSTAKL
IVEELPVRFVKTLEEEVTVVKTQPLYLTCELNKERNVVWRKDGKIIKDKPGKFALGIIGL
SHSLTIIDSDDADAGTYSVTVEDTELSCSSCVKVVEVIRDWLVKPIRDQHVKPKGTATFT
CDIVKDTPNIKWFKGDEEIPAEPTDKTEILKEGNKIFLKIKNAGPADIGEYSVEVEGRRY
PAKLTLGEREVELLKPLEDVTVYEKETANFDTEISEEDIPGEWKLKGEILRPSPTCEIKA
EGGKRFLTLHKVKLEQAGEVLYQALNAFTTAILTVKEIELDFAVPLKDVTVPERRQARFE
CVLTREANVIWSKGTDILKIGEKFDIIADGKKHILVINDSQFDDEGEYTAEVDGKKSTAR
LFVEGVRLKFISPLQDQTVKEGETAHFQFELSHEDMPVKWYKNEKRLHTSRTVFMTSEGK
VHKLEMREVTLDDISEIKAVVKDLNTQANLKVLEADPYFTVKLQDYSAVEKDDIILECEL
SKDVPVKWYKDGEELVASNRISIKTDGLRRILKIKKAAESDKGVYECDCGTDKTSANVSV
EPRLIKVERPLYGVEVFVGETARFEIEISEPDVHPIWKLKGETLTPSPECEIIEDGKKHA
LVLHNCKLDMTGEVSFQAANAKSAANLKVKELPLIFITPLSDVKVFEKDEARFECEVSRE
PKTFRWLKGTQEITPDERFEIISDGTKHALIIKSVAFEDEAKYMFEAEDKITSAKLIIEG
IRLKFITPLKDVTKKERETAVFTVELSHENIPVIWFKNDQRLHTSKVVSMADDGKFHTLT
IKDLTIDDTSQIKVEAMGKSSEAKLTVLEGDPYFTGKLQDYTAVEKDEVILQCEISKADA
PVKWMKDGKPITPSKNVVIKADGKKRILILKKALKKDIGQYTCDCGTDQTSAKLNIEDRD
IEIIRPLYSVEVVETETARFDIEISEEGVHGNWKLKGEPLTESAECEIKEEGKKHFLTLY
NVRLDQAGGVDFQAANAKSGAHLRVKPRVIGLLRPLKDVTVTAGESATFDCELSYEGIPV
EWFLQGKKLEPSDKVVTRAEGRVHTLILRDVKLTDAGEVSLTAKDFRTQANLFVKEPPVE
FTKPLEDQTVEEEATAILECEVSRENAKVKWFKNGEEIHKTKKYDIISDGRVRKLIIYGC
TLDDAKTYTCDAKDFKTSCFLNVEPIRVEFLKPLTDLEVKEKESARFECEISRPGVKVKW
FKDGIEIRKGKKYDIISQGAKRILVVSKCAFDDEAEYACEAKTARTSGLLTVIEEEAVFT
KNLPDLEVNENDTVKLICEVSKPNAEVTWFKGDEEVPDGGRFEHITDGRKRILIIRNAHP
EDAGKYTCKLPSSSTTGKLTVHELAAEFLTKPQNLEVLEGDKAEFFCSVSKEAITVQWLR
GDTVLEPDDKYDIISDGKKRTLVVKDSILGDAGKYTVMVGEAKATARLTVIEKLRIITPL
KDQEVNEGQEIIFNCEVNKEGAKEKWYKNDEAIFDSAKYIIVQKDLVYTLRIRDAQLKDQ
ATYTISLSNKRGEHAKSSAALTVLEEDLRIIEPLEDIETMEKKTVTFWCKVNRLNATLKW
TKNGEEITFNKRILYKIDKYKHSLIIKDCGFVDEGEYTVTAGQDKSVAELLITEAPADFI
EHLRDQTVTEFDDAVFTCQLSKEKASVRWYRNGREIKEGKKYQFEKDGNLHRLIIKDCRL
DDECEYSCGVDDRKSRARLFVEEIPVEIIRPPQDIYEAPGADVIFMAELNKDGVEVKWLR
NNMIIVQGDKHQMMSEGKVHRLQVCEIKPRDQGEYRFIAKDKEARAKLELAAAPRIKTGD
QNLVVDVGKPLTMTVPYDAYPRAEAEWLKGEESLPTTTVDTTTDCTTFKIYEAKKSDKGR
YKVILRNKHGQAEAFINVEVIDVPGPVRNLEVTETYDGEVGLAWQEPESDGGSKIIGYVV
ERRDIKRKTWITVTDRAENCEYIVTGLQKGGVEYLFRVSARNRVGTGEPVETERPVEAKS
KFDVPGPPQNVDVTDVNRFGATLTWEPPEYDGGSPITGYIIELRNRGSIRWEPTMTTGAD
ELSAVLTDVVENEEYFFRVRAQNMVGVGKPSPATRAVKIMDPIKRPSPPINLDHSDQTKS
SVQLTWEPPLEDGGSPVLGYIVERQEEGTDKWIRCNPKLVPALTYKVTGLKPGSRYYYRV
SAENAAGVSDPAEAIGPLTADDTFVGPTMDLSAFKDGLEVIVPEPIKIRVPITGYPVPTA
TWSFGDQVLEEGDRVTMKTTASFAELVITPSERPDKGIYSLTLENPVSSVSGEINVNVIA
RPSAPRELKVLDIIKNTVQLSWEPPEDDGGSPVTGYIIEKREVSRKTWSKVMDHVVDQEF
TVPDLIQGKEYLFRVSACNKCGPGEPAYIDEPVNMSAPATVPDPPENVKWRNPTSKGIFL
TWEPPKYDGGARIKGYLVEKSQRGTDKWEICGEPVVETKMEVTKLKEGEWYAYRVKALNR
IGASKPSKPTDDIQAIDAKEAPEIFLDVKLLAGLTVKAGTKIELPAKVTGKPEPQVTWTK
ADKILRPDDRITIETKPNHSTVTITDSKRSDSGTYIIEAVNSSGRATAVVEVNVLDKPGP
PAAFDVSEITNESCLLTWNPPRDDGGSKITNYVLEKRATDSEIWHKLSSTIKDTKFRATN
LTPHKEYVFRVSAENMYGIGEPVECSPIIAKYSFDPPGPPTGLKPTEVTKDSVTLTWNEP
DEDGGSPITGYWVERYDPEQDKWIKCNKMPVKDTTFKVKGLTNKKKYKFRVLAENLAGPG
KPSKETEPILVKDPIDPPWPPGKPTVKDVGKTSLFLNWTKPEHDGGAKIESYVIELLKTG
TDEWVRVAEGVPTTEHFLKGLMEKQEYSFRVRAVNKAGESEPSEPSDPVLCKERLYPPSP
PRWLEVINITKNTADLKWTVPEKDGGSPITNYIVEKRDVRRKGWQTVDTTVKDTKYTVSP
LTEGSLYVFRVAAENAIGQSDYCEIEDSVLAKDTFTTPGPPYALTIVEVTKGHVDLKWEP
PKNDGGRPIQRYVIEKKEKLATRWVKAGKTAGPDCNFRVTDVIEGTDVQFQVRAENEAGC
GHPSEPTDLIHIEDPTSPPSPPQDLHVTDAGRNHICIAWKPPEKNGGSPIIGYNVEMCEA
GTEKWMRINSRPIKDLKCKVEEGVVPDKEYVLRVRAVNAVGASEPSDISEKVVAKDPDCN
PTIDLKTRDIVVVKGQKLRIPIPFRAVPSPTITWHKDGKELKAGDRTTMKSDYTSALLEV
IDSVHADAGVYTITLENKLASTTGSVNVKVIGPPGQCKDIKASEVTKNSCKVSWEPPDFD
GGTPILHYVLERREAGRRTYIPVMSGENKLSWQVKDLIPNSEYYFRVKAVNKIGGGEYLE
LRNPIIAEDPKQPPDPPVDLEVHNPTSKSVTLTWKPPLFDGGSKIMGYIIEKLAKGKERW
ERCNEYLVPLLTYPVKGLEEGKEYQFRVRAENAAGISEPSRITPFVKAVDPIEAPKVFLA
ANLQSGLEVKRGDEIILEAHISGSPYPSITWLRNDEVVRPEEIKKRVTTYTRKKKGEVEE
EKPFQLSLPERMSIDNHKEGESVLSVRDSIRADHGTFTIKVENDHGVAKASCEVNVLDIP
GPPVNFVFEDVRKNSVICKWEPPLDDGGSEILNYVLEKKDNTKAEMGWVTVSATLRHCKF
HVTKLIEGKEYLFHVFAENRVGPGPPCVSKPMIAKDPFSPPDPPNKPDVQDVTSNSMLVK
WNEPKDNGSPIIGYWIEKREINSTHWARVNRNLVNALEIKVEGLLEGLTYIFRVCAENAA
GPGKFSPPSDPKTAQDPIMPPGPPIPRVADTSSTSIELEWEPPVYNGGGDITGYHVYKQL
VGVNEWSRCTEKPIKVRQYTVKEVREGADYKLRVTALNAAGEGPPGETEPTTVAEPKEPP
TVELDVSVKAGIQIMAGQTIKIPATVTGRPTPTIAWTVEDGELDKDRVVIENVGTKSELT
IKNALRKDHGRYVITATNSSGSKSAGTRVEVFDVPGPVLDLKPVVTNRKMCLLNWSDPED
DGGSDIIGFIVERKDAKMHTWRLAIDTERSKCDITGLVEGQEYKFRVSAKNKFGTGPPVE
IGPILAVDPLGPPTAPERFMYTERTKSSITLDWKPPRSDGGSPVLGYIVEKRRHDSKDYE
RVNARLCPTTSLLVEKLDELHMYEFRVKAVNAIGESEPSLPLNVVIQDDEVPPTVTLRLA
VRGDTIKVKAGEPVNIPADVTGLPMPKIEWDKNEVLIDQTSSALKITKEEVSRSEAKTEL
ILPAAVRDDKGTYTVRASNRLGTAFRNVHVEVYDRPSPPRNLAVSDIKAESCYLTWDAPL
DNGGSEITHYIIEKRDASRKKSEWEEVSKSAVERRFGVWNLATNEKYQFRVRAVNKYGIS
DECLSEKVVIKDPYGLPGPPGKPKILDRTRSSMLVTWEPPLNDGGSPITGYWLEKREVGG
VYWSRVNRAPVTKPSVKGLQYNVLRLAEGVEYQFRVMAENLAGIGPPSEPSDPALAADPI
FVPGPPSCPEVKDKTKSSVVLAWKPPQKDGGSPIKGYIVEMQDEGSTDWKKVNEGDKLFP
TCECVVPNLKELRKYRFRVKAVNAAGESEPSPATSDIPVQDILEEPEIFLDIGAQDFLSC
RAGTTIKIPAVIKGRPIPKTFWEFEGKAKTTAKEGGHNVPEEAQVEATDTRSVITIPECN
RSHSGRYSITAKNKAGQKTVHVRVNVLDVPGPPKDLKVSDITRGSCKLSWKMPDDDGGDR
IRGYVIEKRNIDGKAWTKVNANCGSTSFVVPDLISGQEYFFRVRAENRFGVGPPAETIQR
TTARDPIHPPDPPIKLKIGLVTKNTVSLTWKPPKNDGGAPVTHYNVECLRWDRTGEVKET
WKQCNRRDVEETKFTVEDLVEGGEYEFRVKAVNIAGPSRPSATVGPLVVKDQTCPPSIEL
KEFMEVEEGTDVNIVAKIKGVPFPTLTWLKASPKKPDDKTPVLYDQHVNKIIGEDTCTLL
IQQSRRSDTGLYTITAVNNLGTASKEMRLNVLGRPGPPVGPIKFESILADKMTISWLPPL
DDGGSKITNYVIEKKEANRRTWVPVTNEPKECLFTVPKLMEGHEYVFRIMAQNKFGIGEP
LDSEPETARNLFTVPGPCDKPTVSSITRDSMTVNWEEPEHDGGSPITGYWLERKETTGKR
WTRVNRDPIKPMTLGVSYKVTGLIEGSEYQFRVSAINAAGVGPPSMPSDPAIARDPIAPP
GPPIPKVTDWTKSSVDLEWTPPLKDGGSRVTGYIVEYKEEGKEEWERVKDKEIRGTKFVV
AGLKEGCFYKFRVRAVNAAGIGEPGEVTDIIEMKDRIVAPDINLDASVRDRIVVHAGGVI
RIIAYVSGKPAPTVTWSRDDRALPEEAKIEETAISSSLVIKNCKRSHQGIYTLLAKNAGG
ERKKNIIVDVLDVPGPVGMPFLTENLTSDSCKLTWFTPEDDGGSPITNYIIEKRESDHRA
WTPVSCTVTRQNATVQGLTEGKAYFFRIAAENIIGMGPFTETTKELVIRDPITVPDRPED
LEVKAVTKNSVTLTWNPPKYNGGSDITMYVLESRLIGKEKFHKVTKEKMLDRRYTVEGLK
EGDTYEYRVSACNIVGQGKPSFCTKPITCKDEIAPPSLDLDFRDKLIVRVGEAFSLTGRY
SGKPAPKVTWLKDDIVVKEDDRTKIKTTPTTLCLGILKSVRGDSGKYCVTVENSTGSRKG
FCQVNVVDRPSPPVGPVIFDEVHKDHMVVSWKPPLDDGGSEITNYIIEKKDAHRDLWMPV
TSATVKTTCKIPKLLEGREYQIRIYAENLYGISDPLISDEMKAMDRFRVPDAPEQPIIKD
VTKNSAVVVWNKPYDGGKPITNYIVEKKETMATRWVKVTKDPIFPSTQFKVPDLLEGCQY
EFRVSAENEIGVGDPSPPSKPIFARDPIAKPSPPVNPEAVDKTKNSVDLSWQPPRHDGNG
KIIGYLVEYQKVGDEEWKKANLTADSCPETKYKVTGLTEGLTYKFRVKAVNAAGESEPAY
VPDPVEVKDRLEPPELILDANMAREQHVKAGDTLRLSAVIKGVPFPKVSWKKEDHEVSPK
ADIEVTGVGSKLEIRNTVHEDGGIYSLTVENPAGSKTVSVKVVVLDKPGPPRNLQVSEVR
SDSCYLTWMEPEDDGGSVITNYVVERRDVASAQWVAISSTSKKRSHMAKYLIEGTQYLFR
VAAENQFGRGPYVETLKPIKAVDPLHPPGPPKNLHHVDVDKTEVSLVWNRPDRDGGAEIT
GYLVEYQEDGADEWTKFQTVPMLDCVVTGLQKGKIYKFRVKAQNIVGLSLPDTTIPIECQ
EKLVPPSVELDVKLIEGLVVKAGTTVRLPAIMRGVPVPTAKWATDGIEIKSDGRHKIDTD
NFSTVLTIKDCVRKDTGEYLLTVSNAAGSKTVALHLTVLDVPGPPTGPINILEVTPEHMV
ISWRPPKDDGGSPIINYIVEKRQSKKETWGVVSSGTSHTKIKIPRLQKGYEYIFRVRAEN
KIGIGAPLDSEPTIAKHMFDPPSPPGKPTVYDITENAATVSWTLPKSDGGTPITGYILER
REASGKWVRVNKTPILDMKYRVTGLFEGNTYEFRVFAENMVGLSKPSPSSDPIKASRPIT
PPGPPINPKLKDKTKETADLVWTKPLKDGGSPILGYIVECQKTGTTQWNRINKDELIRQC
AFRVPGLIEGNEYKFRIKAVNIVGEGEPRELAETVLAKDILSPPEVSLDVTCRDLITVRV
GQTIRITGKVKGRPDPDITWSKDGKVLVQEKRVEIVHDLPNIELQVKEAKRSDHGKYIIA
AKNSCGHAQAFAVVNVLDRPGPCQNLKISYVTKDSCMIAWESPVDNGGSEITNYIVEYRQ
PNQRGWSIVSSDITKRLVKANLIENREYFFRVCAENKIGPGPCIETKTPILAINPIDKPG
EPENLHIAEKGKTFVYLKWRRPDYDGGSPNLSYHVERKLKDSDEWERVHKGSIKETHYMV
DKCVENKIYQFRVQTKNEAGESDWVRTAEVVVKEDLQKPVLDLKLSGVLTVKAGDTIRIE
AGVRGKPQPEVVWTKDKDATDLTRSPRVSIETTSDTSKFVLTKSRRSDGGKYVITATNTA
GSFVAYATVIVLDKPGPVRNLKVTDISSDRCTVTWEPPEDDGGCEIQNYILEKCESKRMV
WSTYSSSVLTNYANVTRLIEGNEYIFRVRAENKMGTGPPTETHPIIAKTKYDRPGRPDPP
DVTRVSKEEMTVVWNPPEYDGGKSITGYILEKKEKRSLRWVPVTKTPIPERRKKVTNLIP
GHEYQFRVSAENEVGLGEPSLPSRPVVAKDPIEPPGPPTNLRVVDSTKSSITLGWGKPVY
DGGAPIIGYVVEIRPKVEGADPEAGWKRCNVAAQLIHTEFTATSLDENQLYEFRVSAQNQ
VGLGRPAELKEAVSPKEILEPPEIELDASMRKLVTVRAGCPIRLFAIVRGRPAPKVTWRR
MGIDNVIRKGQVDLVDTMAFCVIPNSTRDDSGKYSLTLVNAAGEKAVFVNVRVLDTPGPV
VDFKASDVTKMSCHLSWAPPENDGGSPVTHYILQKREADRKTWGTVTAELKKTSFQIANL
VPGNEYFFRVIAVNEYGSGVPSDIPKPVLATDPLSEPDPPRKLEVTEITKNSATLGWLPP
LRDGGSKVDGYIVSYREDDQPADRWTEYSVVKDLSIVVAGLKEGKKYKFRVAARNAVGVS
LPRETEGVFEIKEQLIPPKILMPDHVHIKAGKKLRIEAHVYGKPQPVCKWLKGDQDVLTS
SRLAVHKAEKSSVLIIKDVTRKDSDFYTLTAENSSGTDSQKIRVIVMDKPGPPQPPFDIS
EIDADACSLAWHIPLEDGGSNITNYVVEKCDVSRGDWVTALASVTKTSCRIGKLIPGEEY
MFRVRAENRFGISEPLTSGKMIPRFPFDVPSEPKNARITKVNKDCIFVAWDRPDSDGGSP
ITGYLIERKERNSLLWVKANDTAVRSTEYPCVGLIEGLEYTFRIYALNRAGASKPSKPTE
FVTARAPVDPPGKPEVIDVTKSTVSLVWTRPKHDGGSKLIGYFVEACKLPGDKWVRCNTT
PHQIPLEEYTATDLEENAQYQFRAIAKTAVNISRPSEPSDPVTIHPENVPPRIELDLSMQ
SQLTVKAGTNVRLEANVYGKPMPTIKWKKEGEVLKPSEGVKITTKRNLATVELFSVNRKQ
TGDYTITAENASGSKSATIKLKVLDKPGPPASVKIKNIYADRAMLSWEPPLEDGGSEITN
YIVDKRETSRPNWAQVSANVPITSCTVEKLIEGHEYQFRICAENKYGVGDPIFTEPAVAK
NPYDVPGPCDPPIISNVTKDFMTVSWKPPASDGGSPITGYILEKRETKALNWTKVNRKPV
IERTVKATGLQEGTEYEFRVIALNKAGPGKPSAPSKAVYARDPQYPPGPPAFPKVVDTTR
NSISLSWSKPAYDGGSPIIGYLVEAKRADTDNWVRCNLPKNLQATRFVVTGLMEDTEYQF
RIYAVNKIGYSDPSDVPDKHTAKDILIPPEGELDAELRKVLVLRAGVTMRLYVPVRGRPP
PKITWSKVGANLRDRQGLDIKSTDFDTFLRCENVNKYDAGKYVLSLENSCGKKAYTIVVK
VLDTPGPPINLIVKEASKDSAFITWEPPLIDGGSPITNYVVEKRDAERKSWSTVTTECPK
TSFRVTNLEEGKSYFFRVFAENEYGIGDPCETRDAVKASETPGPVVDLKASAVTKSSCNL
VWKKPISDGGSRIFAYVVEVLIGEDNWQEVMRAKNLHFSMRDLKEGQEYTFRVRAQNDAG
YGTPTELTIVARDDVVAPDLDLRDLPDLCYIAKEGSNFRLKIPIKGKPVPTVTWKKDEDQ
ALAESGRVAFDSTAVNTTLVVHDCQKADAGKYTITLKNVAGSKEGTISVKVVGKPGIPTG
PVKFEEVTADAITLKWGPPKDDGGSEITNYVLEKRDNVNNKWVTCASAVQKTMFRVTRLH
EGNEYTFRIRAENKYGVGEGLKSDPVIAKHPFDVPDAPPPPNIVDVRHESVALTWTDPKR
TGGSPITGYHIEVKERNSLLWKRANKTPIRMKDFRVTGLTEGLEYEFRVMAINMAGVGKP
SLPSEPVVALDPIDPPGKPEVINVTRNSVTLIWTEPKYDGGHKLIGYIVEKRDLPSKTWT
KANHVNVPDCAFTVTDLTEGSKYEFRIRAKNTAGAISPPSESTGTIICKDEYEAPSIVID
PTLKEGLTVKAGDTITVSAISIRGKPPPTSAWSKAGKDFRPSELVHIETTPTSSTLTVKY
AARKDSGEYTITATNPFGTKQESIHVKVLDVPGPPGPIEISNVSAEKATLTWSPPAEDGG
SPVKSYVLEKRETSRLLWTLIAENIESCRHVVSKLIQGNEYIFRVSAVNQYGKGEPVQSE
PVKMVDRFGPPGPPGKPEVTNVTKNTVTVTWKRPVDDGGSEITGYYVERREKKGLRWVRA
TKKPVSDLRCKVTGLLEGNEYEFRVSAENRAGVGPPSDASNSVVCKDVAYPPGPPANPRV
TDTTKTSASLAWGKPHYDGGLDIIGYIVEHQKEGEEEWVKDTTGTALRITQFVVAHLQTG
AKYNFRISAMNAAGVGEPAIIPSVEIKDREEIPDFELDAELRRTLVVRAGLTIRIFVPIK
GRPTPEVTWTKDGVSLKGRASIENTDSFTLLIVTECTRYDAGKYLMTLENAAGKKTGFVN
VKVLDTPGPPINLKPREITKDSITLQWDMPLIDGGSRITNYIVEKRESTRKAYSTVTTNC
QKCSFRIPNLAEGCEYYFRVLAENEYGIGEPAETAEPVRASEAPSPPESLNIMDVTRNSV
SLAWPKPEHDGGSKITGYVIEAQRKGTNQWAHITTVKTLDCVVKNLTENEEYTFQVMAVN
SAGRSAPRESRPVIIKEQTMLPEFDLRGIYQKTVIAKAGDNIKIEIPVLGRPRPTVTWKK
EDQILKQTQRVNYENTATATILTINECKRSDSGQYPLSAKNIVGEVSEVITVQVHDIPGP
PTGPIKFDEISSDFVTFSWEPPLNDGGVPISNYVVEMRQTDSTTWTELATTVIRTTFKAI
RLTTGVEYQFRVKAQNRYGIGPAITSESVVANYPFKVPGPPGTPQVIAVTKETMTISWNE
PVTDGGSPILGYHIERKERNSILWQTVSKMLVSGNIFKSTGLTDGIAYEFRVIAENLAGK
SKPSKPSEPVFALDPIDPPGKPIPLNITRHAVTLKWTKPEYNGGFKITGYTVEKRDLPSG
RWLKANFSNILETEFTVSGLTEDAAYEFRVIARNAGGAVSQPSEPSDAITCRDDIEAPKI
KVDAKYKDTLVLKAGEVFRLEADVSGRPPPTMAWTKGEKELEDTAKLEIKIADFSTVLIN
KDSSRRDGGAYTLTATNPGGFAKHIFNVKVLDRPGPPEGPLAVSEVTAEKCVLSWLPPLD
DGGAKIDHYVVEKRETSRLAWTAVATEVPLTKLKVTKLLKGNEYVFRVMAVNKYGVGEPL
ESEPILAVNPYVPPDPPKTPEVTAITKDSMVVCWGHPDSDGGSPITNYIVERRDRTGLRW
VKCNKRVVTDLRYKVSGLTEGHEYEYRVMAENAAGVSEPSPTSPFYKACDTVFKPGPPGN
PRVLDSSKSSITIAWNKPIYDGGSEITGYMVEIALPEEDEWKIVTPPIGLKATSFTITDL
KENQEYKIRIYAMNSEGLGEPALVPGTPKAEERMLPPEIELDAELRKVVTIRACCTLRLF
VPIKGRPAPEVKWTREHGESLDRASIESTSSYTLLIVENVNRFDSGKYILTIENSSGSKS
AFVNVRVLDTPGAPQDLKIKEVTKSSVTLTWEPPLIDGGSKIKNYIVEKRESTRKAYSTV
NANCHKTSWKVDSLQEGCNYYFRVLAENEYGIGLPVETSESVKVSERPLPPGKITLLDVT
RNSVSLSWEKPEHDGGSRILGYIVEMQSKGSEKWSTCATVKVTEATITGLIQGEEYTFRV
SAQNEKGISDPRQLGIPVVAKDLVIPPAFKLLFTTFSVLAGEDLKVDVPFVGRPKPAVFW
HKDNVALKQTTRVNAESSENNTVLTIKEACREDVGSYLVKLTNSAGEATETLNIVVLDKP
GPPTGPVKVDEVTADSITISWEPPKYDGGSSINNYIVEKRDTSTTTWHIVSATVARTTIK
ACRLKTGCEYQFRIAAENRYGKSTYLTSEPIIAQYPFKVPGPPGTPFVTNVSKDSMVVQW
NEPVNDGGSKIIGYHLERKERNSILWAKLNKTPIPDTKFKTTGLEEGLEYEFRVYAENIV
GIGKASRASECYTAHDPCDPPGRPEPIIVTRSSVTLQWKKPVYDGGSKITGYVVEKKELP
DGRWMKASFTNVIDTQFEVTGLVENQRYEFRVIARNAAGVFSEPSESSGAITARDEVEPP
HISMDPKYKDTIVVNAGESFKLDADVHGKPIPSIQWLKGDSELTNTARMEIKTTDFATSL
SVKEAIRIDSGQYVLLAKNVAGEKKVPVNVKVLDRPGPPEGPVEITGVTAEKCMLSWKPP
LQDGGSDISHYVVEKRETSRLVWTVVDSNVQTLNCKVTKLLEGNEYVFRIMAVNKYGIGE
PLESEPVLAKNPFVVPLPPKAPEVTAITKDSMIVVWERPASDGGSEILGYVLEKRDKEGI
RWTRCNKRLISELRYRVTGLIENHDYEYRVSAENAAGLSEPSPPSTYYKACDPIYKPGPP
NNPKVVDVTRSSVFLSWSKPIYDGGSEIQGYIVEKCDVSDGEWSICTPPTGIKNTHMEVE
KLVEKHEYKFRICAVNKAGVGEHADVLDSVIVEEKMEAPDLDLDMELRKIVNVRAGGSLR
LFVPIRGRPTPEVKWGKMDGEIREAAIIDTTSSFTSLVLDNVNRFDTGKYTLTLENSSGT
KSAFVTVRVLDTPSAPVNLKIREITKDSVSLSWEPPLLDGGAKIKNYIIEKREATRKSYA
AVVTNCHKTSWKVDQLQEGCYYFFRISAENEYGIGLPEETSDPIKVAEVPQPPGKITVDD
VTRNSVSLSWEKPEHDGGSKIIQYIVEMQAKGSEKWSECARVKTLEAVITNLTQGEEYLF
RVMAVNEKGKSDPRALAVPIIAKDLVIEPDVRPAFHSYSIQVGQDLKVEVPIAGRPKPTV
TWVKDGQPLRQTTRVNVSDLTDLTILNIKETSKEDGGTYEITVANVVGQKSASVEIITLD
KPDPPVGPVKFDEISAESITLSWNPPAYTGGCQITNYVVHKRDTTTTVWETVSATVARTT
LKVTKLKTGSEYQFRIFAENRYGQSFALESAPVVAQYPYKEPGPPGTPFVTTVTKDSMVV
QWHEPINDGGSRVLGYHLERKEKNSILWAKVNKSIIQDTSFKTTNLEEGIEYEFRVSAEN
IVGVGKTSKVSECYVARDPCDPPGRPEAIIIKRSSITLQWTKPEYDGGSKITGYIVEKRD
LPDGRWMKASFTNIIETQFTVTGLTEDQRYEFRVIAKNAAGAISKPSDSTGPITARDEVE
LPRISMDPKYKDTIVVSAGETFRLEADVHGKPLPTIKWYKGDKELEETARYEIKNTDFSA
LIIVKDAVRVDGGQYILEASNVAGTKTVPVNVKVLDRPGPPEGPVQVTGVTAEKCSLAWS
PPLHDGGSDISHYIVEKRETSRLAWTIVASEVLPTMLKVTKLLEGNEYIFRIMAVNKYGV
GEPLESVPVMMKNPFVVPGPPKALEITNITKDSMTVCWNRPDSDGGSEIIGYIVEKRDRA
GIRWIKCNKRRITDLRLRVTGLTEDHEYEFRVSAENAAGVGESSQVSPYFKACDPMFKPG
PPTNAHVVDTTKSSITLGWSKPIYDGGCEIQGYLVEICKADEDEWSLVTPQTGVRATRFE
IKKLTEHQEYKLRVCALNKIGVGEAASVPGTIKPEDKLEAPELDIDSELRKGIVVRAGGS
ARIHIPFRGRPTPDITWSREEGEFTEKVQIDKGINYTQLSIDNCDRNDAAKYILKLENSS
GSKSAFVTVKVLDTPGPPQNLVVKDIKKDSAVLSWEPPIIDGGAKVKNYVIDKRESTRKA
FANVSAKCGKTSFKVENLTEGAIYYFRVMAENEFGVGVPAETTDAVKASEPPLPPGKVTL
TDVTQRSASLTWEKPEHDGGSRILGYIVEMLPKGTDKWSVVSETKTCNAVVSGLSPGQEY
QFRVIAYNEKGKSDPRALGIPVIAKDLTIEPSFKLMFNTYSVQAGEDLKVEVPFIGRPKP
TITWAKDEQPLKQTTRLHIQDTSTSTILHIKESNKEDFGKYTVTATNTAGTATEHLSIIV
LEKPGPPRGPVRFDEVSADFVVLSWDPPDYTGGCQISNYIVEKRDTSTTIWSIVSATVAR
TTIKATKLKTGSEYQFRISAENRYGKSSPLDSKPVVVQYPYKVPGPPGTPFVTAASKDHM
IVQWHEPVNDGGSKVLGYHLERKDKNSILWTKQNKSLIADTKYKTDGLEEGLEYEFRVSA
ENIVGIGKVSKVSELYVARDPCDPPGRPEAIVVTRNNITLKWKKPEYDGGSKITGYIVEK
KELPDGRWMKASFTNVLETEFTVSGLVEDQRYEFRVIARNAAGCLSEPSESTGPITARDE
IEAPRASLDPKYKDVIVVHAGETFVLEADIHGKPIPDITWSKDGKDLEEATARMEIKSTI
QKTILTVKDCIRLDGGQYTLNLRNVGGTKSIPITVKVLDRPGPPEGPLKVTGVTAEKCYL
AWAPPLHDGGSSISHYIIEKRETSRLSWTQVATDVQALNYKVTRLLAGNEYIFRVMAVNK
YGTGEPLESEPIVARNPYKSPGPPSTPEVSAITKDSMVVTWGRPEDDGGAEIEGYILEKR
DKDGIRWTKCNKKRLTDLRFRVTGLTDGHFYEFRVSAENAAGVGQPSEPSIFYRACDVLY
PPGPPSNPKVTDTSRSSVSLAWSKPIYDGGAPVKGYVVEVKEAAADEWTTCTPPTGLQAK
QFTVTKLKENQEYNFRICAINSEGVGEPATIPGTVIAADKIEPPEIELDADLRKVVTVRA
SGTLRLFVTIKGRPEPEVKWEKAEGTISERAQIEVTSSYTMLVIDNVNRFDSGRYNLTLE
NNSGKKSAFVNVRVLDTPSAPINLTIREVKKDFVALAWEPPLIDGGAKITNYVVEKREST
RKAYATVTNNCTKNSFKITQLQEGCSYFFRVLAVNEYGVGLPAETPDPVKVSEPPSPPAK
VVLVDVTRNSVSIKWEKPESDGGSKITGYIVEMQTKGSIKWSACTQVKTLEATITGLSMG
EEYSFRVIAVNEKGKSDPRELGIPVIAKDIEIQPSAELLFNTYTVKAGDDLKIDVPFRGR
PLPTISWKKDGNALKETTRVNIQTSKTSTSLSIKEASNEDLGHYELHLSNTAGSTTASLT
VVVLDRPGPPTDVHIDEVSADSITLSWKPPAYDGGCHISNYIVEKRETTTTTWDVVSAAV
ARTSIKVSRLTTGSEYQFRICAENRYGKSTYTNSPSVVAEYPFKPPGPPGTPHVVHATKT
FMVVTWQIPVNDGGSRVLGYHLERKERSSILWTKVNKSLIPDTQMKVTGLDEGLLYEYRV
YAENIAGIGKCSKSCEPVAARDPCDPPGQPEVTNITRTCVSLKWTKPEYDGGAKVTGYII
ERREIPDGRWLKCNFTNVQETYFDVGGLTEDQRYEFRVIAKNAAGLFSQPSESTGPVTVK
DDVEAPRIMMDAKFRDVVVVKAGEVFKVNADIAGRPIPVISWTKDGKELEGKARVEIVST
DHTTAITIKDCIRGDSGQYVLTLQNVAGTRSLAINCKVLDRPGPPAGPLEINGLTAEKCH
LSWGPPQENGGADIDYYVVEKRETSRIAWTLCEGELRTTSCKVTKLLKGNEYIFRVMGVN
KYGVGEPLESVAVKALDPFTVPSPPTSLEITNVSKDSITLCWARPESDGGNEISGYVIER
REKTSLRWIRVNKKPVYDLRVKSSGLREGCEYEFRVYAENAAGLSLPSETTPLIRAEDPI
FLPSPPSKPKIMDSTRSNITIGWTKPLFDGGAPVTGYTVEYKKTDETDWTMAIQNLRGTE
YTITGLISGSEYVFRVKSINKIGVSEPSDVSEPQVAKEREEEPAFDIDSEMRKTLIVKAG
GSFTMTVPFRGKPVPNVTWNKPDTDLRTRASIDTSDNCTSLTIEKATRNDSGKYTLTLQN
ILNTATLTLIVKVLDTPGPPSNITAKDVTKESAVLSWDVPENDGGAPVKNYVIEKREASK
KAWVTVTNNCHRLSYKVTGLQEGAIYYFRVSGENEYGVGVPSETKEGTKITEKPSPPEKL
GVTNVTKDSVSLSWLKPEHDGGSRIVSYLIEALEKGQQKWVKCAVVKTTHHVVHGLKENV
DYFFRVFAENQAGLSDPKELLLPVTVKEHLESPEIDMKGFPHNTVYIRAGSNLKVEIPVS
GKPVPKVTLSRDGVPLKPTMRFHTETTAESLIINLKESVAADAGRYDITAANSSGTTKSF
VNIVVLDRPGPPVGPVVLSDITEESVTLRWQPPVYDGGSQVTNYIVLKRETSTAAWSEVS
ATVARTVIKVMKLTTGEEYQFRIKAENRFGISDHIDSQCVVVKLPYTTPGPPSTPWVMNV
TRESITVGWHEPVTNGGSAVTGYHLEMKDRNSILWQKANKTLIRTTHFKVTTISAGLIYE
FRVYAENAAGVGKASHPSDPVLAIDACEPPRNVRVSDISKTAITLSWQKPAFDGGSKITG
YIVEKRDLPDGRWTKASFTNVIETQFTVSGLTQNSRYEFRVFAKNAVGSISNPSDVVGPI
TCVDTYGAPEIDVPPEYTEVVKYKAGTSVKLKLGISGKPIPTIEWFKNGNEVQTSALMSI
ENTTEFASILIKDATRLNSGSYELKLKNAMGSASAHVRVQILDKPGPPSGPIQFKTVTAE
KITIMWDPPEDDGGAPVTHYVVEKRETSRVVWSLISEKLEGCIITTTKVIKGNEYVFRVR
GVNKFGVGDSLESEPVIAKNSFVTPGPPSVPEATMITKNSMTVVWNRPTVDGGSEISGYF
LEKRDKKSLSWFKVTKETIRDTRQKVTGLTENSEYHFRVCAVNAAGQGPFSEASDFYKAA
DPVDKPGSPTKLKVVDTTKTSVTLGWIKPAYDGGSPITSYVVEKREGEEQEWTVVSHKGE
VRTTEYVVSRLQPSVNYYFRVSAINCAGQGEPIEMTEPVQAKDILVAPEIDLDVALRTSI
VAKAGEDVQIMIPFKGRPPPTVTWRKGDKNLGTDERYIIQNTESSTLLTIPQVTRNDTGK
YVLTIENGVGEAKSSFVNVKVLDTPSACQKLQLKHVSRGTVTLVWEPPLINGGSEITNYV
VEKRDATKRAWSTVTTKCSHTTFKLTNLSEKTAFFFRVLAENEIGLGEPCETSEPVKAAD
IPGPVKDLAMKDSTKTSVKLQWSKPDYDGGSIISDYVIEKKLQEEKEWAYAGTSKSCEFE
VEKLKELSVMEFRVFAKNEKGMSDGVTIGPITVKEHIITPEADLSDVPGGQIAVRIGHNL
HIELPYKGKPKPSMSWLKDNLPLKETEHLRFKKTENKISLSIKNVKKEHGGKYTLILDNV
VCRKTFTIVVITLGPPSKPKGPLRLDEIKADSVVLSWEAPEDDGGGEITGYSIEKRETSQ
INWKLVCSSAARTTFKVPNLVKDTEYQFRVRAENRYGVSPPLVSADVVAKHQFRPPGAPG
KPVVYNITADGMTISWDAPVYDGGSEIIGYHVEKKERNSILWQKVNVALISNREYRITGL
LEGLDYQFQVYAENTAGLSRASEPSKFTLAVSPVDPPGTPDYIDVTRETVTLKWTPPLRD
GGSKIVGYSIEKRQGSEDRWLRCNFTDVSECQYTVTGLSSGDRYEFRVLARNAVGTISPP
SQSSGYIMTRDENIAPTIEFGPEHFEGLTVKAGESIRLKALIKGRPVPKVTWFKDGKEIE
KIMNMEITTAIGYSTIFIRDATRDHRGVYTVEAKNASGTKREDITFRVQDTPGKVGGPIR
FTNITGEKVTLWWDPPANDGCASISHYIIEKRETSRIAWALVEDKCEACSYTALKLIKGN
EYQFRVSAVNKFGVGRPLESDPVTAQIPYTLPDAPGTPEPTNVTGDSITLTWARPKSDGG
SEINEYILERREKKSMRWVKVSSKRPITENRYRVTGLVEGNEYEFHVMAENAAGVGPPSD
VSKLIKCREPVSPPSAPNVVKVTDTSKTSVSLEWTKPVFDGGMEIIGYIIEMCKADLEAW
QKVNAETVLATKYTVVDLEAGEHYKFRVSAVNGAGKGESCEVPASVQTVDRLSAPEIDID
ANFKQTHIVRAGASIRLFIAFSGRPVPTAVWSKADANLSLRADIQTTDSFSTLTVEECNR
NDSGKYVFTVENNSGSKSITFTVKVLDTPGPPGPITFKDVTRGSITLMWDAPVLDGGSRI
HHYIVEKREASRRSWQVVSSKCTRQIFKVTDLAEGVPYYYRVSAENEYGVGEPCELTEPV
VATEEPAPPKRLDIVDTTKSSVVLAWLKPDHDGGSRVTGYLLEMKQKGSDSWIEAGQTKQ
LTFTVEGLVENTEYEFRVKAKNDAGYSQPREAFSSVIIKEPQIEPTADLSEISRQLITCK
AGSTFTIDIPISGRPAPKVTWKLEEMRLKETERVTIKTTKDRTTLTVKDSMRGDSGKYYL
TLENTAGVKTFTVTVVVIGRPGPVTGPIEISSVSAESCVLTWKEPEDDGGSDITNYIVEK
RESGTTAWQLVNSSVKRTQIKVTHLTKYQEYSFRVSSENRFGVSKPLESKPIVAEHPFVP
PSPPSRPEVYSVSATAMAIRWEEPYHDGGSKVIGYWVEKKERNTILWVKENKVPCCECNY
KITGLVEGLEYQFRTYALNAAGVSKASEASRPVVAQNPVDPPGRPEVTDVTRSTVSLRWS
APLYDGGSKIIGYIIERKPYTASGDGRWLKCNYTIVSENFFTVTALSEDEAYEFRVLAKN
AAGVISKGSESTGAVICKDEYSPPKAELDARLQGEVVTIRAGSDLVLDAAIGGKPEPKVF
WSKGDRELDLCEKISLQYTSKRAIAVIKFCDRSDSGKYTLTVKNASGMKQLSVLVKVLDS
PGPCAGKITVTRVTEEKCTLAWNIPEEDGGAQITHYIVERRETSRLHWVIVEAECQTLSY
VVTKLIKNNEYIFRVRAVNKYGPGVPLESEPVIARNAFTIPTQPGAPEEVSVGKEHIIIQ
WTKPESDGGSEIKDYLVDKRERKSLRWTRVNRDYTVYDTRLKVTGLMEGSQYQFRVTAVN
AAGNSEPSEASQYMLCKEPSYTPAPPSTPRVVDTTKHSISLAWSKPTYDGGADILGYVLE
MKEEGTEQWYRPHTTATLRNAEFTVTGLKTAQKYQFRVAATNVNGMSEFSESSAEIEPVE
RIEIPELELADDLKKTVTVRAGGSLRLMVSVSGRPAPVITWSKQGVDLVSRAIIDTTDSY
TLLIVDKVNRYDAGKYVIEAENQSGKKSATISVKVYDTPGPPAAVRIKEVSKDSVTLTWD
IPTIDGGAPVNNYIIEKREASMRAYKTVTIKCSKTFYRVTGLLEGALYYFRVLPENIYGI
GEACETSDAVLVSDVPMVPQKLEVIDTTKSTVTLAWEKPSHDGGSRLTGYVIEASKAGTE
RWLKVVTLKPNVYEHTIISLNEGEQYLFRVRAQNQKGMSEPREIVTAVTVQDQKVLPTID
FAGIPQKTIHVPAGKPIELAIPIEGRPPPAVSWFFAGSKLKESERIKMETVAKTAKLTVR
ETTIHDTGEYTLELKNTTGTVTDTLKVIILDKPGPPVGPIRIDDIDSNYVTISWEPPELD
GGATLSGYVVEQRDAHRPGWLPVSESVTRTMFKFTRLVEGAEYVFRVAATNRFGIGSYLQ
SEIIECRSRIRIPGPPGTPEVFDVSRDGMTLTWYPPEDDGDSQITGYIVERKEVRADRWI
RVNKVPVTMTRYRSTGLVEGLEYEHRVTAINARGTGKPSRPSKSAVARDPIAPPGKPQNP
RVTDTTRTSVSLAWSPPEDEGGSKVTGYLIEMQKVDQFEWTKCNTTPTKIREYTLTHLPQ
GAEYRFRVLACNAGGPGEPAEVPGTVKITEMLDYPDYELDEKYQEGLMVRQGGVIRLTIP
IKGKPIPICKWTKEGHDISKRAMIATSDTHTELVIKDAEREDSGTYDLALENKCGKKAVY
IKVRVIGIPNPPEGPLEYDDIQARSVRVSWRPPTDDGGADILGYIVERREVPKTAWYTVD
SRVKGTSLVVKGLKENVEYHFRVSAENHFGISKSLKSEEPAVPKTPLNPPEPPNNPPEVL
DVTKSSVNLSWSRPKDDGGSRVTGYYIERKETSTEKWVRHNKTQITTTMYTVTGLVPDAE
YQFRIIAQNDIGESEASPPSEPVVCKDPFDKPSQPGEIEITSIFKDSITLEWERPESDGG
KEILGYWVEYRQSGESTWKKCNKERIKDRQFTVGGLLEATEYEFRVFAENQTGLSRPRRT
AMAVKTKLTSGEAPAIKKEMQDVTTKLGEAAQLTCQIVGRPLPDIKWYRFGKELVQSRKY
KMSSDGRNHTLTVITDEQEDEGLYTCMATNDVGEIETSGKLLLQAPPQFHPGFPLKEKYY
AGAGGTLRLHIVYIGRPVPAITWFHGNKPLRGSETITIENTEHYTHLAIKNVQHKTHAGK
YKVQLSNTFGTVDTVLNVEIQDKPEKPVGPIVIESILKNSVVISWKPPEDDGGAMITNYI
IEKREAKEGAEWQLVSSSISGTTCRIVNLTENAGYYFRVFAQNTYGISEALEVSSVVVMK
PLFEKPGQPGQPVASAITKDSCVVSWKPPASDGGAKIRTYYLEKREKKQNKWISVTTDEI
RETVYSVKDLIEGLEYEFRVKCENLGGESEWSEVSQPVIPKSDVPIQAPHFKEELRNLNV
KFQANATFVCKVTGHPKPIVKWYRQGKEIMPDGEKIKIQEFKGGYHQLVITNVTDDDATV
YQVRATNQGGSVSGTASLDVEVPAKIHLPKNLEGMGAVHALRGEVVSIKIPFSGKPHPVI
TWQKGQDLIDTNGHYQVIVTRSFTSLVFPNGVDRKDAGFYIVCAKNRFGIDQKTVELDVA
DVPDPPRGLKVTDISRDSVNLTWNEPATDGGSRIINYIIEKRATTAERWIRVAQARDTRY
TVVNLFGKTTYQFRVIAENKFGQSQPSEPTDPIITKEDKTRVMNYDEEVDETREVTTVKA
AHYSTKELYDKYMIAEELGRGQFGIAHRCVEAVSKKTYLAKFVKVKGADQVLVKKEISIL
NIARHRNILYLHESFESLEELVMIFEFISGVDIFERISTASFELNEREIVSYVRQVCDAL
EFLHRHSIGHFDIKPDNIIYFTRRSSVVKIVEFGQARQLKPGDSFRLQFTSPEYYAPEVH
HHDLVSTATDMWSVGALTYILLSGINPFIAETNQQVIENILNAEYNFDDEAFKDISIEAM
DFIDRLLVKERKARMTAAEALNHVWLKQQTEKTSTKVIKTLRHRRYYQTLVKKEWNTVVS
VARISCGGAIRTQKGITVAKVKVAPIDIGPIAGQIKHTVTEEGGHAKYVCRIENYDQSTQ
VTWYFGMRQLESSEKYEIKYEEGVATMYVKDVSKSDDGTYRCKVVNDYGEDSSYAELFVK
GVREISEHYRCRTVRKVKRRVDTMRLLERPPEFTLPLYNRTAYIGENVRFGVTITVHPEP
RLTWFKSGQKIKPGDDDKKYTFESDKGLYQLIINNVTEEDDAEYSIVARNKYGEDSCKAK
LTVIPHPPPADATLRPMFKRLLANAECQEGQNVSFEIRVSGVPKPTLKWEKDGQPLSFGP
NFDIIHEGLDYYALHIRETLPEDSGYYRVTATNSAGSTSCQAYLKVERLKYVKREYKTEE
EREKHVQRQIDKTLRMAEILSGVEAVPLTQTAQEALREAAILYKPAVSTKNVKGEYEIKK
EEKKEERRLRMPYEVPEPRKHVRTTLEEDQNIKHFVPLSDMKWYKRLRDQYEMPGKLERT
VQKRQKRIRLSRWEQFYVMPLPRISDQYKPKWRIPKLTQDDLEIVRPARRRTPSPDYEYY
FRPRRRSLGDLSDEELLLPIDDYLAMKRTEEERLRLEEELELGFSASPPRSPPRFELSAL
RYSTAGAQVRSEEERKRELRYSSYHIPTKAETSATYAELRQRHDRAAYRPPKQKQRIMDE
REDEELLRPVGTAQRLSEYRSELEYMAEEEKSRLRRRREREITEITSEEEEEIEMVQHVH
REFSPPSRLLRRRRSLSPTYIELMRPVSELIRPRSRPPEESERRSPTPERTRPRSPSPVS
SERSLSRFERMARFDIFSRYESMKSALKTQKAMERKYEVLTQQPFTLDHAPRITLRMRSH
RVPCGHNTRFILNVQSKPTAEVKWYHNGIELQESSKIHFTNTSGVLTLEILDCHIDDSGT
YRAVCTNYKGECSDYATLDVTGGDYTTYSSQRRDEEVPRSILPDLTKTEAYAVSSFKKAS
ATESSSSLREVKSEMSATRESLLSYEHYAASEEKITAAEEKSLEERTVHKTFKSTLPATI
LTKPRSITVAEGETARFSCDADGEPAPVITWFRAGQPIVSSRRFQVTRTQYKSTFEISSV
QMSDEGSYTVVVENSEGRQEAHFTLTIQRTKIPAKTITSPPTIKSPEPHVKSPEPVKSPK
RVKSPEPISGPPRAKSPPGDKSVPAEKVQLLTASPPKIKQQLKAETLGDKVKLSCAVESN
VLSVREVAWYKDGKKLKEDHHFKFHYAADGTYELKIHELMESDKGEYTCEIIGEGGISKT
SFQFTGQVFKNIHSQVRGVSETHKTVRKEDEVLTVSTQKKSAVATEEKAAVQEVIKKSVV
TEDVKQLKAEIKASSTKMTVSEGQKLMLKANIPGACEVKWVLNGMELRNSDDYRYGVSGS
DHTLTIKKASNKDEGILTCEGKTDEGIIKCQYVLTFSKERSNEPAFIMQPKSQNVNEGQD
VLFTCEVSGDPSPEIEWFKNNQPIAVSSHIRVTRSKNVYSLEIRNAAVSDTGKYTVKAKN
YHGQCSATASLTVLPLIEEPPKEVVLKTSGDASMHESFSSQSVQMASSKQEASFSSFSSS
SMTEMKFASMSAKSMSSMKESFVEMSSSSIMGKSSMAQLESSTSKMLKSGLRGVPPKIEA
LPSDISIDEGKVLTLSCAFSGEPAPEITWYCRGRKITSQDQRGRFHIETSEDLTTLIIMD
VQKNDGGLYTLNLGNEFGTDSATVNINIRSI
NT seq 103596 nt NT seq  +upstreamnt  +downstreamnt
atgacgacaaaagcaccaacatttacacagccattacaaagtgttgtggcactggagggt
agtgccgcaacctttgaggctcatattagtggtttcccagttcctgaggtgagctggtat
cgggatggccaggttctttctgctgcaactctgcccggtgtgcagatctcgtttagtgat
ggccgcgctaaactggtgatccccaccgtgacagaagcaaacagtggaagatacaccgta
caagccaccaatggatctggacaagcaactagtactgctgagctacttgtcacagctgga
accgcaccaccaaacttcgcacaacgactacagagcatgactgcaaggcagggaagtcaa
gttcgacttgacgtgagagtgactggaatccctacacctgtggtgaagttctatcgggat
ggagtagaaatccaaagctcccccgattttcaaattttacaagaaggagacctttacagc
ttaataattgcagaagcatatcccgaagactccggtacctattcagtaaatgccacaaat
aacgtgggacgtgctacttcaacagctgaattgctaattcaaggtgaggaagaagccgtt
cctgctaaaaagacaaagacaattgtttcgactgctcagatttcacaaacaagacaagcc
agaattgaaaagaagactgaagcccactttgatgccagatcacttacaagtgttgaaatg
gtcatagaaggtgtgacagcccaacagctcccacacaaagcacctccacgaatgcctcct
agacctacgtcaaaatcaccaaccccaccaataattgctgcaaaagcacaaatggcacga
cagcaatcaccatcacctgttagacaatcaccatcacctgtaagacatgtcagagcacca
acaccctcaccagtaagatcagtttctcctgctggaagaatctccacctcacctattaga
ccagtgaaatctccatccccaatccgtaaaacacatgtagtgacaacaggtggggccgaa
gtccttcctccttggaagcaggaaggttatactgcaaccacagaagctcagatgaaggaa
acaagagtatctacaagtgctacccaaataagaactgaagaaagatgggaggggagatat
ggggtccaagaacaagttaccgttagcggtgctactgctggtgaggtggcagctggtgct
agagaggtaaaaaaggacagtgaaaaaacagcagctgttgctacggttgttgctgctgtg
gatcaagccatggtgagagaaccacctccaggtgttgtagagcaaacttctaaaaggaca
gcaatgactgcagtccacgttcaacctgttcgggagcagatgagaaaggaggcaacggta
gtagttaccagtgataaagctacaaaacaaacagtaatatcaagaactagagaaggaatt
gttacttcacaagaacaaaggcacatctctcatgaaaagatacaaaaagaaccagagaaa
actccactaccaacagcaataattgccacagacaaagccaaagaacaagaaagaatatca
agagctagagaagaagtatctaccagacatgagcaagtgcacattgctcatgaaaagata
agaaaggaagatatcaaaccttctgtacctaaggtagtaattaccgctgataaacctaaa
gcaccggtcataatatcgaaaagtaaagaaggaattgctaccaaacaagaacaagtgagc
ataacccatgaaaagattaaaaaggaagctaagaaaactactgtagttccgaaaataatt
gctactgataaaaccaaagcaccaatcacagtgtccagaactagagaagaaattacagcc
aagcaagaacaaatccatctaacttatgatcagaccgaagctggaaaaagggctgaagct
gtagctacagttgttgcagcagttgatcaggcacgtgttcgatcaccctgggaacccgaa
caagcagatgaagcttatgtaaagcagaaaactttggcatatggctataaagagcatgct
gttacagaccatgctgctgaggccccagcagaacgtcatgttgtcactaaagaagttaaa
acagtctatgttcctcctgagaaacatatcgcagctactgaaaagaaggaaattcagtta
tcaacagagataaaaagagcaacagaaactgagaaaacaattcacattgaacatccgcga
ccccgcacagcaagtcctcacttcacagtctcaaagattgctgttcctaaaccagatcat
acgtatgaggtttcaatagctggatctgccatggctactctggaaaaagagttatcagct
actactgctgcgcaaaagatcaccaagcctgtgaaaccacctcagctaaagccacacgaa
gtcaggataaaagcagagccagctgcccctccacagtttccttttggggaggctgctgaa
gcctataaaagtcgctatgatgttgagactagaaaagaggcaggtgtaagcattaaaggt
gaagcagtgtgggaagaacacttggtgtcgaggaaagaaggtgaagcaaaggtgacagaa
actgccagagttcctgtacctgcagaaatccctgctactccacccaccttagtctcgggc
ctcaaaaataagactgtgactgaaggcgagtctgtcactctggagtgccatatctctggt
catcctcagcctactgtgacatggtacagggaagactacaagattgagagctcaatggac
ttccagatcactttcaaagcagggcttgctcgccttgtgattcgtgaagcctttgcagaa
gacagtggaagatttacctgcactgctaccaataaggctgggagcgtcagcacatcttgc
caattatatgtgaaagtttcagaagaaattgagactcgagaaaccatttctgagaaggct
gttaaagaagagaaacgctatgtggagacaaaggacattgtaatggaagatgtctctgct
gcagcagaggaagtatcaggagaacccatacctcctttcttcataagaaaacccatagta
cataaattaattgaaggtgggagcattatttttgaatgtcaagtagggggcaacccaaag
ccacatgtctactggaaaaaaggtggagttcctctaacgactggctacagatacaaagtg
agttacaaaagagaaaccggggaatgcaaacttgaaatttcaatgacttttgccgacgat
gccggagaatatactattgttgttcgtaataaacatggagaagcttctgcaacggtctcc
ttactagaagaagctgattatgatgcctacgtaaaatcgcaacaagaaatgatgtaccaa
actcaggtgactgcatatgtacaggaaccaaaagtggctgaggtagccccagctatttca
tatggtgactttgaaaaagagtatgaaaaagagcaagccctaattaggaagaaaatggca
aaagatacagtgatggtcagaacttttgtagaagatgaggaattccatatttcttctttt
gaagaaagacttatcaaggaaattgaactcagaattattaaaaccaccttagatgaactt
cttgaagaagatggagaggagatgatggttgatatttctgaatctgaagctatagaagca
ggtttcgatttaagattaaaaaattacagaacctttgaagggacaggagttactttccat
tgcaagacgactggatatccattgccaaagattgcatggtacaaagatggtaagcgcata
aggcatggagagcactaccacatggaagttctgcaagatggcagtgccagtctgcgtttg
cctgttgttttacctgaagatgaaggaatttatactgtctttgccagtaatatgaaagga
aatgcaatttgctcagcaaaactctatgttgagccagttgcacccacagcaactccaggt
tatatgccaggaccagaagttatgagaagatatagatctctttctccacgctctccaagc
cgatctcctgcccgcagttctccttctcgttctcctgcccgcagattagaagaaactgat
gaaggacaactagagagactatataagccagtttttgtgctgaaacctacatcgtttaag
tgttcacaaggacagacagcaagatttgacttaaaagttgttggcagacctatgccagag
acatactggttccataatggtcaacaagtggttaatgactacacccataaaatagttatt
aaagaagatggcacccagtcactgatcattgttcctgctatgcctgatgactctggagaa
tgggctgtaattgctcagaatagggcaggcaaagcttccgtctcaatgacactgagtgtg
gaagctaaggaagacctagtcagaccacactttgtggaaaggctgaagaatgttagcgta
aaagagggctccagactggagatggcagtgagagctactggtaaccctaatcctgacatt
gtatggctgaagaacagtgacatcattgtacctcataaatatcccaaaataaagattgag
ggaaccaaagggacagctgcccttaaaattgaatctactgccaggcaagatgctgcatgg
tatactgctactgctatcaataaagctgggcgagacactactcggtgcaaagtaaatgtt
gaagttgaacatgcagaacctgaaccagaaaggaggttaatcattccaaaaggaacttac
aaagccaaggagattgcagcaccagagttagagcctctccatctgcgttatggtcaggag
caatgggaggaaggagatctatatgacaaagaaaagcaacagaaaccattctttaagaaa
aagctcacatctttacggctcaagcaatttggcccagcacactttgaatgcaggcttaca
ccaattggtgacccaaccatggtggtggagtggttgcatgatggaaaacccttggaagca
gctaacaggctccgcatgatcaatgagtttgggtactgtagcctggactatggagtagcc
tattccagagatagtggagtgatcacttgcagggcaactaacaagtatggtacagaccat
acatctgctactctgattgtgaaggatgagaaaagccttgtggaagaatcccagttgcca
gaaggcagaaggggactgcagcgaattgaagagttagaaagaatggcccatgaaggtgct
cttcctgcagttgcagtggaccaaaaggaaaaacaaaaaccagaaattgttttggttcct
gaacctgcaagagtcctggaaggtgaaacagcacgattccgctgccgtgtgactggctat
cctttgcccaaggtcaactggtacctcaatggacaacttattcgtaagagcaaaaggttt
agactccgttacgatggaatctactacctggatattgtggactgcaaatcgtatgataca
ggagaggtgagagtcacagcagagaatccagaaggctttattgaacataaggtgaaactt
gagatccagcagagggaagacttcagatctgttcttcgtcgtgctcctgaacccaaacac
gagcctgtagtgacagagcctggaaaacttctctttgaggtacagaaggtagacaaacct
gcagaggcaacaaccaaagaagtggtgaaactgaaaagggctgaaagaatcactcacgag
aagctttcagaggaatctgaagagctgcgtagtaaattcaagcgtaggacagaagagggc
tattatgaagccatcactgctgtggagcttaagtctcgcaaaaaagatgaatcatatgaa
gaaatgttaaaaaagacaaaagaagaacttcttcactggaccaaagagattccagaggaa
gagaagaaagcacttcctcctgaaggcaaaatcaccattccaacattcaaaccagagaag
gttgagcttagtccaagcatggaggctcccaagatatttgaacgaattcaaagccagact
gtagcccaggggacagatgcacacttccgtgtgagagtggtgggcaaaccagaccccgag
tgccagtggttcaaaaatggtgtgcagattgaaaggactgaccgtgtgtattggtactgg
cctgaagataatgtctgtgaattagtcatcagagatgtgacttctgatgattctgccagc
atcatggtgaaagcattcaatatagctggtgaaacttctagccatgctttcctgttagta
caagccaagcagttaatcagcttcacccagaagttacaagatattgtggctaaagagaga
gactccatggcaacatttgaatgtgagacatcagaaccctttgtcaaagtgaaatggttt
aaggatggaattgagatttattctggagagaaatacaggatgcactcagacagaaaggct
cattttctttctgtgctagcagttgaaatgtctgatgctgatgactacagctgtgcactg
gttgaagatgaatccataaaaactactgcaaagcttactgttgaaggtgctgtggtagag
ttcattaaagaacttgaggatgtcgaagtaccagaatccttctcaggtgaacttgaatgt
gaggtttccccagaagatgtggaggggaaatggtatcatggtgacgttgaactcacttcc
aatcataaatatgtgattgcatcccgccgtggtcgccaaattctcactattaaagatgtt
aataaagatgatcaaggagagtatagctttgttgttgatggaaaaaggactcgctgcaaa
ctgaagatgaagcctcgtcccatggctatacttcaaggacttactgatcaaaaagtttgt
gaaggagatattgtacaacttgaagttaaagtctccctagaaaatgtggaagctgtctgg
atgaaagatgggcatgaaattcaatcaagtgatcgtattcacattgtgttggataaacag
tcacacatgttgctgatagaagatgctacaaaggaagatagtggaacttactcttttaat
gttcctggtcttggactgtcaaccactggacggatcacagtgtacagtgtggaaatagtg
gtgcctctaaaagatgttcacgtagttgaaggaacaaaagctatcctcgaatgcaaagtt
tcagcacctgatgtgtcttcctccaaatggtacctaaatgatcatcagataaagcctgat
gaacgtgtacaagctgtatgtaaaggcactaagcagaggctggtgcttaccagaacccat
gcatcagatgaaggacgttataaactaatggttggcaaagctgaaacaagttgcaatgtc
acagttgaaaaaattcagattattagaggtcttcatgacatcacctgcactgaaacacag
aatgtatcctttgaggtcgagctgtcccactcaggaattgatgtaatatggcaattcaaa
ggccaagaaattaaggctggtcctaaatataaaatcgaagcacgtggcaaaatacataaa
ttgacagtggtgaagatgatgaaagatgatgaaggagaatatgtattttatgctggagag
aagaaaacatctggaaagcttatagtagcaggtggtgctatttcaaagccccttactgac
ctgactgtggctgagtcccaggcagctgtttttgaatgtgaagtggcaaatcctgaatca
gatggccagtggctaaaaaatggtagaccattacctatgacagatcagtaccgttctgaa
tctgatggtgtaaagagaaggctcaatatccctgtcacgaaactggatgatatgggtgaa
tatagctatcaaatagcaagttcaaagacatctgccaaactgaaggttgaagctgttaag
ataaagaagacactaaagaacttgactgtgacagaaacacaggaggcagttttcactgta
gaactgacccaccctgacgtgaaaggagctctgtggattaaaaatggtgttgaacttgaa
tcaaatgacaaatatgacatttcagtgaaaggcactgttcacacactgaaaatcaaacac
tgtgttgtcactgatgagtctgtttatagctttaagcttggaaagataggagcaaatgcc
agacttcatgtggaaactgtcaagatcatcaaaaagccaaaggatgtgactgctttggaa
aatgctgttgtctcctttgaactgagtgtatcccatgacactgtaccagtccgatggttc
cacaaaaatgttgagcttaaacaaagtgataaatacaagatgatctctcaaaggaaagtt
cacaagcttatgctgcataacatatctcctgctgatgctggggaatacacagctcttgtt
gggcaaattgagtgtaaagctaaactgtttgtggaaaccatacacatcacaaagaccatg
aaaaatattgagattcctgagaccaaaaccgcttcttttcaatgtgaagtttctcatttc
aatgtgcctgctgtctggttgaaaaatggtgtggagattgaaatgagtgaaaagttcaaa
atagtggtccaggggaaactccatcagctcaatatcatgaacacaagcagtgaagattct
gcagaatacacatttgtctgtggaaatgacagagtcagtgcaactctgaccgtaaaaccc
atcttaattacctccatgctaaaagacatcaatgccgaagagaaagatacaataacattt
gaagttactgttaactatgaaggaatctcatataaatggctaaagaatggggtagaaata
aaatcaactgataaatgccagatacgaacaaagaagctcacacactccctctccataagg
aatgttcattttggtgatgctgcagaatacacttttgttgctggaaaagcagcttcatcg
gccactttatatgtggaagctcgtcacattgaatttaggaagcatattaaagacatcaag
gttgtggagaagaagagggctatttttgagtgtgaaatttcagaacctgacattcacgtc
cagtggatgaaggatggacaagaactccagattggtgacaggatgaaaattcagagagaa
aagtatgtccatcgtctcatcattccttccacaagaatgtctgatgctggtcagtacact
gtagtagcaggtggaaacacatccagtgccaatttgatagtggaaggtcgtgacattcgt
atcagaactgtccgtaaagatattcaggtcattgagagacaaagagctgaaattgaattt
gaagtcaatgaagatgacattgaaccacagtggtacaaggatggtattgagatcaacttc
caatatgaggaaagatacagttatgtggtggagaggagagttcatcgaatgagcatcttt
gaaaccacttactctgatgctggagaatatacttttgttgcaggacggaataggagttct
gttgttctctatgtgaatgctccagagccacctcagattattcaggagctagagccaacc
actgtggagtctggcaaacctgcccgcttctgtgctatgatatcaggcaaacctcagccc
aaaatctcctggtacaaagatgatcaacaactttctccaggtttcaagtgcaaatttctt
catgatgcacaagaatatactctattgctgatagaaacttttcctgaagatgcagcagtg
tacacctgtgaagcaaaaaatgactatggagttgctacaacttcagcttcactttcagtg
gaaatcccagaagttgtttctcctgagctagaagtgccagtgtatccacctgctgtcata
ataccactgcgtgatgctgttacatccgaggggcagtctgcttgttttcagtgcagagtt
acagggacagatctgaaagtctcttggtacagcaaagagagagagatcaagccatcacgg
ttttttagaatgactcagtttgaagacacttaccagctggagattgctgaagcttatcca
gaggatgaaggaatctatacctttgtggctagtaattctgtaggccaagtgacaagcact
gctaccttgaagttggaagctcctgaaaaaattattcatgagaaactagaggaagagatt
gaaatggaagtgaaagacattgctagctctcttattgtgtcttctgaggaaggaagaagt
gaaggctacagcagcggctttcagttgcctgatagagagaaaacacttgaatttgaacct
gaaaaaccagtttattccagcaatgcaaagatgaaaatggaggaggggggcaaagcccct
tttttcctcaaacgggtctcagatgttgaagtctggcagggagatgtagctaggctttct
gttactgttactggcagccccacacccaaaatccattggtttttcaacaggatgaagctg
accccatccacagactgtaagttagtgtttgctggcaatgaccacagcctcatcctccca
tatgcaggtgtgcagaatgagggcgagtacaggtgcgtggccagcaatgtacatggtgag
atcacatgcagtgcccacctccacgtgcggcagcggataccaggggtcccttactttgcc
agggagccagacagtgtgaggtgtgctccaggctttactgcagtctttgaatacaccgtg
gctggggagccatgtccagatgtgcaatggttcaaggggactgagcagctcttctctgat
gcacggcgttctgttgctcaccatcctgacggcacgggctccctgacagtgtgggaatgc
atggaagaggacactgggctctacatgtgcagggcagtgagcaccctgggtgaagccaca
tgctctgctgagctccttgtgctgcccgaggagcatgctgtgtgcaggcagaatccagtc
ttgcaacactctgctgtggcagaggaccaaagccccttttcctatgaggaggctgttgag
cttcctgccatggaaggagcactcagccttgaggccatgagggagtccccagctctcgtt
cagcttcagacaagtcaggtggagcatgtgctgcgcagagaggacatcttgcctggcctg
ccaccagcctgcctggctgcacagagtgtcgaagagatgctagctcaggtggccacaaca
catgagagcagcaggcttctggcagagccactgcaaactctccctgatggcccccagggt
gtggtgcctgcagcagcaatggagacacaactgccgggctgtcttgggattgtagctgca
cagatactcttgcccaaagaggaagtcatccccaaggcagccgagcaaatggctactctg
aagacagagacttcccaagcccttctacaggtgtcaagcagcaccgacagttgtgccata
gatggtgaccacatccaggtccttgagggcttacaggcaatgcaaagtgagctgaaggct
gaacccagatttccttctgaactggctatcactgggggccaagctgtgcccctggagcac
atttcttccctgaaagcagcagaggaagattttgctgcaagaatttgtgagggacaggct
gtgagatttccattgctgctagaagaaaaccagcccctagaggaggaacatgtcatcaac
cttgccagcccacttaggcagtatccaagggcagggagacaaccccatgaaaaaatgtac
agtcaccaacttcagccaagccaagtcctcaacaaggagagccagctcactgctcagttt
cccaagagctacaacttagacataaagtctcaagctagaaatgcactgaaagctgcagtg
gtaagtgagcaaaacctcttgttttcagaatggttggctgataaagaaaacattgaagtg
cagacaataaacatcaccaaggaacaaaaccacaccctatgcacctatgttgtgaccaca
ggaggactcagtcccacagaaatctcagtctccttgggagaagtcagcattcagacagtt
gaccagaaaacagtcttgaaggaggctttctgttctcttatttgtgaagaaaaacatctc
ttgacaggtgaaaaatccaaagcattgcctgtccatcccagtccacttctctcaggagaa
tcctgtgatgaagcctctaaactggagccccagcaggctgaaagaactatagaggcagaa
atacccctggagcagcctttatctgcacaaataatcaacactgtgaccaggcatggtcaa
atcaaggatgtgggcgcagctgcagccactgctgatgtagcctccacaggtgttcccatt
gagacacccacagaaatactgaaaaggaaggagaatagggaagaaatgtgtgaggaagag
gaaagagagagtctggaagagttagaagatgagctgggcaaagagggttgtcccatcata
cacaccaaactggtcaacactgttgtggaggaaggggagagtgtcagtctggtgtctgtc
ataacaaatgccagagaggtgaactggtactttgagggtaaactggtgtcttcaggtggc
aaattcaagtgtttgcaagatcaggacacatacatgctagtaataagcaaagcgtgtgag
gagattcaccaaggagagtacacctgtgtggcactgaatcaaggtggaaaaagagcaaca
gcagcaaaactcacagttgttaaaagagttgcaccaatcctgaggagaaggctcgaatct
ctagaggtggctgtaaatcatgtggccaagtttacctgtgaagtagagactgctcccaat
gtcagattccagtggtacaaagctggccgagagatatatgatggggacaaatactccatt
cgcacctccaactacttctccacattggagatcccgaggccacaggttgttgactgtgga
gagtatagctgcaaggcttccaaccagcatggcagtgtaagctctacagcccttttaaca
gtaactgaagcgcttccaccaacttttcttaccagacctgaatctatcactacttttgtg
ggcaaaagtgccaagttcctgtgtactgtttcggggactccagtcatcgacgtcgcctgg
cagaaggatggcacaaccatttcaccttcagaccaccataagatctccaaagtagaaaat
aaacatatgttagaaatttcctgtctcaccaccagtgacagaggggtttacacttgcaaa
gcttccaacaagtttggggctgacatttgccaggctgaaatggtcattatagacaagccc
cacttcattaaagttttgcagtcagtgcagtcagcagtcaataaaaaaatacatcttgaa
tgtcaggtagatgaagacaggaaagtaacagtagggtggacaaaggatggaaacaaaatc
cctccaggcaaagattataaaatttactttgaagacaaaatagcctcgcttgaaattcct
ctggctaagctcaaggattcaggccattatgtgtgcactgcctcaaatgaggcaggaagc
agctcctcttctgccagcatcacagtcagagaaccaccatccttcgtgaagaagatcgat
ccatcttatttactgaccccaggagactctgcacgccttcaatgcaaaatcaaagggtct
cctgaaatccaggttacttggtttaagaacaataaggaaatccgtgaaagcaacacgcac
aggatgtcctttgtcaattctgtggctgtgttagatattttggaaatgaaagttgatgac
agtgggagctactcatgtgaagctgtaaacgaggttggaagtgacagctgcgccactgaa
gtagttgtcaaagagcctccatctttcatccgaacactggaaccagcagaggtagtgaag
ggaacaaacaccgttcttcagtgtgaggttgccggcactggaccatttgagattagttgg
tacaaagacaagaaacagattcgcagtagtaaaaaatacaggttgacctctcagaaagct
gttatttctctggaggtgtcctcatttaatagtgcggatgttggtgaatacgagtgtatg
atagctaatgaagtcgggaagtgcgtatgcagtgcaacatacatcttgaaagaaccacca
tcttttgttaagaaaatcgaaaatgtgacagctctgtctggagacagtattacattacag
gctgtggtgaaagggtcggagcctatttctgtgatgtggatgaagggcaaagacattatt
caagatgataacaaagtgagagtgacatttgaacacggtctagcaacactgcaaattacc
ggtgtccagctgagctctggtggcaaatacacttgcgtagctgagaacgatgcaggaagt
cagtcctgctttggtgaattagcagtgaaagaacctgccaaaatcattgaaaaatctgaa
atgatccaggtaacagcaggggaaccagccattttggagtacactgtcacaggcactcca
gagctaaaaaccaaatggttcaaagatggaaggccactacctgctagcaaaaaatacagg
atcagctttaaaaataatattgcccagctcaagttttatgctactgaaatgcaggacagt
ggcgagtacacctttgagatatccaatgatgtgggcatcagctcttgtactaccagcttc
actgtgctagatcgcactctccctcccttctttactaaaccactgaagaatattgacagc
atcattagcacctcgtgccgcctagactgcaaaatttcaggctctcttccaatgaccgtc
tcttggtttaagcaggacaccgagatcacttcaagtgccaagtacacagtacactttgca
gaaggctctgcatctttggaaataaaacacctagatccaagtgatgctggggtctacatt
tgcagagccacaaactctgctggtagcaaagagagcagtagcactttgtttataaaagag
ccacccagcttcactgtagaacctgagtcccaggatgtactgcctgcatcaactgtacgt
ttcaaaggcacatttaaaggcacaacaccactaacggtgaaatggtttaaaggtgatact
gaactggtgacaggaggagcctgctacattatgacagaagccttagcaagttacttggag
ctttatgcagtcaaaccaacagactcaggaagatacacctgcaaagtctccaatgtagct
ggttcagtaacatgcagtgcaaacttgtttgtaaaagaacctgctgccttcaaggagaag
ctagagccaacccatctggtaaagaagggtggatatgcagaactgacctgcgaagtcact
ggtactcctgagattaaaatcacgtggttcaaggatgatagagagctaaaagagagtgac
aaatacaggatgtcttttgcaaaatccttggcaacactccatgttacagaggttgagact
gaagacagtggggaatacatatgcgaggtcaaaaatgatgctggaaaagatatttgcagt
agtgttgttactatcaaagagtcaccttattttagcaaggagtttcaatccatggaagtc
ttgaaagattctgatgtggttttggagtgtgaggtgcttggcacacctccctttgaagtg
ttttgggtgaaagatgataaacccgtgcggagcagtaagaagcacaggataagcattgag
aaatctttgattagcctccacgttttcaggtttgatgcttctgatgttggcgagtatcag
tgtagagtaacaaatgacgttgggagctgcctctgcagttcggaggtcacactgaaagag
cccccacagttcctgaagaggatagaaaacattagttcccttcgaggggggacagtcgtg
tttcaggctgctattaaaggttctttgcccatcactgtgtcctggctgaaagacaatgat
gaagtgattgaagacaacaatatcaaaatgacctttgtgaacaatgttgccactcttctg
gtgcggtctattgaactgaaacatgatgggaaatatttctgtcaggctaaaaatgaggca
ggaattcagaggtgttctgctctgctgactgtcaaagagcctgctacaatcgtggacaag
gccgtgtcaatagatgtgactgagggagacccagcaaccttgcagtgtaaattttcagga
acgaaacatattacagccaaatggttcaaagatggcaaggaactgacattaggcccaaaa
tataagatcagtgttacagatactgtctcagtcctaaaggtgcttcatacagagaagaaa
gatagcggagaatacatttttgaggttcacaatgatgttgggagcactagctgtgctgct
agtattaacgttctagatctcattataccacctaaattcaccaaaaagctcaagaaaatg
gacagcattaagggatcttttgtccacctggaatgcatagtgtctggttcacatcctata
agtatccagtggtacaaggacgaccaagagataacagcaagtgaaaagcacaaatactct
ttccatgataatactgcatttctggaaatcaataaactggaaggcacagacagtggctct
tacacctgtgaagcaacaaataaggcaggaagcaaccaatgcagtgggttgttaacagtc
aaagaaccgccatattttgtggaaaaaccccagtcccaagaggttgtgcccaatgctagg
gttcagttcaaagcactggtgaaaggttctactcctctgcagataaagtggtttaaagac
agccaggagctcctttccggagctaatcgatctgtctggaaggacaacacatctagtgta
ctggagctcttctcagctaggacatctgactccgggaactacacttgccagataagcaat
gatgtggggactgcaacttgcaaaacagttttgtttgtaaaagaaccccccagatttatt
cagatgccaacttctgtagtagctttgcgtgaaggacagtccaccacttttgagtgccag
gtagtaggcacaccagagattcatgtcacatggtacctggatgggaatgaagtaactgac
caagctaagtacggcgtctccttcatagacggtttagccactttgaaagtcactcaagcc
agagtttcagatagtgggatttatgtttgtgaagcccacaatgatgcaggtagtgagagc
tgcagcgtcgagctgaaagtaaaagagcctccaacatttattcgggagttgagtcccacg
gaggtagtgaagggtttggaggccacactcgagtgtgaggtgactggtactcctccattt
gaggtgaagtggctgaagaacaataaggagatgttcagcagcaagaaatatgccatctcc
accaaagaatcagtatttactcttaatgtgtctaactgtgatgtctcagatgttggtgaa
tatcagtgtattatatcaaatgaaggtgggagctgttcttgcagcacaaggctcagcttg
aaagaaccaccatccttcatcaagaagctggagaatgtcactagcattttgaaaggtact
gcattatttcagtgcgtcgtagcaggtgctcaaccgttatctgtatcatggataaaagat
gagaaaatactagaagaagatgtgcaccaccatattacctttgagaacagtgtggccaca
ctgaaacttaccaatgttgacctcagccacagagggagatacacctgccaggcaaagaat
gagtccggtgtagagaagtgctttgctttgctttttgtacaagagcctgcacggatcata
gaaaaggctaaatcacttaaagtcactgaaagagaccccgtgactttggagtgtaccgtg
gctgggacaccagagcttcgaataagatggtacaaggatggaaaacagctcctgcccagt
agatactacacaatgagcttcgaaaacaatgtggccagtttcaggattgaacctgtatca
aaggaagatagtggtacatacagttttaaggttgaaaatgacttcggaagtagcacctgt
gaagctgttctgactgtgctagatcaatcaattcctcctgcatttattaaaaagctaacc
aaaaaggataccattctgggatcttctatccaaatggaatgcaaagtctctggatcactc
cccattactgcaaaatggtttaaggatggaaaagagataactgacagtgcaaaatataga
agcctgtgccatgagaacacaatgtcacttgagattgctaatctagagttggcagacagt
gcaaattacacatgcagtgtctctaatgttgctgggaacgattcttgcagtgctgtcctg
actgtgaaagagccaccaagcttcttaataaaacctgaaagccagcaagccattccagat
tccacagtggagtttaaggccacactaaaaggaacaccaccctttacagtaaagtggttc
aaagaagatttagaacttgtatctggcccaacctgtttcattgggattgaagggtctaca
gggttcttaaccctctattcagtggatacttctaagagtgggcactacacttgccacgtt
tcaaatgatgttggcagtgactcttgcactacaacgttgatggtaacagaaccacccaag
tttgctaagaagctagaagcagcaaaagtagtcaagcagggcgactcagcccggcttgag
tgcaaagtaagtggatctccagagatgaaagtagtgtggttcagaaatgaccacgaaatt
gttgccagtgagaaattccggacatcattcattgactctgtggccgtgcttgaaatgaat
catctcagtactgatgaaagtggtgactacatctgtgaagctcacaaccccgcaggcaag
gccagctgtagcaccaaagtcacagtgaaagaacctcctgtctttagcaggaagccctct
ccagtagacatgctcaaaggaactgaggtaaacctggaatgtgagatttcaggaacacca
ccatttgacgttatctggtacaaagacaggagacaaatccgcagtagtaagaagtataag
gttacagccaaaaactaccatacaagcgttcgcattcttaatgttgaagctgcagatgtt
ggtgaatatcagtgcaaagcacagaacgacgtaggaagtgacacttgtttttgcactgtg
aagctgaaagaaccaccaaaattcttgactaaaataaacagcgtgactgttgtggttggt
gaaccagtagagttacaagcaagagtggagggctcccagccaatttctgtgcagtggctt
aaagataaagaggaaattattagagaaagtgaaaacacgaagatcacatttatggaaaac
attgcaactttacaacttgtgcgcacagagacaagcaatgctggcaaatacatctgtcag
atcagaaatgatgctggaagtcgcgagtgcatggctaccttaactattctagagcctgca
gtcattgtagagaaagcagaaccaatgagagttactgtaggagatgcctgtactttggag
tgcaaagtggcaggcacaccagagctttccactggatggttcaaggatggcaaagagctg
accagcaaccaaaaatacagaattactttcctcaataaagtatctacacttaaaattatg
gatgcagaaaaggaagatggtggactgtacacttttgcagtgcagaacgacgtggggaaa
agcagttgcacagcatcagttgatgttttagatcgaatcattcctccttctttcacaagg
aaactaaaggaaaccccttgtgtcctgggttcctcagctttgctggaatgcaaagtgtca
ggttcacctcctatttctgttgcctggttccgaaatggacttaagttagtcaatggggaa
aaacatcaaatctccttttcagataacctatgtattttagaggtgaattcactaagcgac
tcagatactggaacttacacctgcaaagctaccaacatagctggttcagatgaatgcagt
gctgtattgactgtacaagaaccaccttcttttgagaggacaccagagcctctggatgtc
ttaccaggcacaagcatcacttttacatgtgttatcagaggaactcctccttttaaggtg
aactggtttagaggggccaatgagcttgtgccaggggacaaatgcaatatctacttggag
gagtccatggtggagcttgagttatttgatgtaactcctctccaaagtggagagtacact
tgtctagtgactaatgatgctggcagggcaaattgtacagcacaccttacagtaaaagag
ccggctgtctttgtgaaaaaactgagcgatcagtatgtggaacctggcaagcccatcatc
ctggagggcacttatacaggcagcctgcccatctctgtgacatggaagaagaacggccac
accatcacccaatctcagaagtgtagcatcaccaccacagagaaatcctgcatcctggaa
atacttgacagcaccaaagaagatgcaggagagtacacttgccatgttgaaaatgaggca
ggaaaagatgtttgtgaggctgtagtctctaccctagaacctccctattttgttacacac
ttggagcctctcgaggtgtcagttggggattatactacattgcaatgccacattgctgga
acaccagaaatcactgtgtcttggtacaaaggagatacaaaactcaggtctactcctgag
tacaaagtgttctttaaagacaacgttgctacgcttattttcaacaaagtggctagcaat
gacagtggcgaatatatctgcaaggcagaaaacagtgtaggaactgcatctacaaaggct
ctcttaaaagttcaagagcgcaaacgaccaccttcctttgcaagaaaattaaaggacatc
gagcaccctcttggtttaccccttaaatttatgtgtcgtctcaatggctcagaacccatt
actgtgacttggcataaagatggtgtgctgctaagcgatgaccacaatgtgcacacatcc
tttgtagacaatgttgcagtgctgcagctggggcgaactgagatgaatcatactgggcag
tactcctgcacagccaccaatgctgtaggcactgccacctccagtgctaggctcacagtg
gcagaacccaagcaagcacctgtctttgacaccaaactagaatctattgatgtgcctttt
ggagaaagtgctgactttgaatgccatgttactggaacccagccaatacacatcacctgg
tccaaggatggtcgggagatccgaactggaggaaacttcaatattacatttgtagccaac
acagttcaccttcgagtgctcagagtgggtaaaggagactctggacaatatacttgccaa
gctagtaatgaagctgggaaagacttttgctcagcccaactcagtgtcaaagaacctccc
aagttcgtcaagaagcctgaagctttgcggttcgtgaagcagggggacacagttcaactt
gaatgtaaaatcagtgggacaccagagatcagaaccgtgtggtacaaaaatgatcaggca
ctccaggcgagcaacaggctccacatgtcctttgtagactccgtggcaatgctgaccatc
ttgggtgcaacctctgaagatgccggcgattacatatgtgaagcccataactctgctggc
acagccagctgcagcagttcagtcacagtgaaagaaccacctgtttttatcaaggtgcca
agccctgtggacacacttaaaggctcagatgttatcctccagtgtgagatagcagggact
ccaccctttgaggtggcttggttcaaggaccgaaggcaggtcaggagcagcaagaagttc
aaggtgacagcaaagaactccattgccagtcttcatattctcaatctggaatctcaagat
actggagaatatcaatgcaaagctatgaatgaggtgggaagtgacacttgcacctgcccg
gtgaaattcaaagaacccccacgctttgccaagaagctgagtgacactgcaatcttcgtc
ggggagccaacagccctgcaggcagtggtggaaggatcgccaccaatttctgttgtctgg
ctcaaggacaagggtgaagttattagggagagtgaaaatgtccaaatgtggtttatggac
aacattgcaactcttgagattgccagtgcagagggagctgatgttgggaagtacatctgc
cagattaaaaacgatgctggcatgcgggagtgctctgcctttttacaagtccttgaaccg
gcagtcatcttagagaagaccgagccaatcacagtaatggctggcaatccttttaccttg
gagtgcaaagtaggaggaacacctgaacttatcaccaagtggtacaaagacggcagagaa
ctaaggaacgatcgcaaataccaaattacctttttcaataatatatccactttgaaagtt
ttttctgcagacaggggagacaggggcttgtatacttttgaggtgcacaatgaggtgggg
gacagtagctgcacttcctcggttgatgtttcagatcgtcttgttcctccttcattctca
agaaaactaaaggaaacaaatggggtgctgggatcttcagtgcttctggagtgcaaagtg
tctggcacatcccccatatctgtggcctggtttcaggatggaaatgagattgttagtgga
gaaaaatatgaaatctcattcttggataacgtttgtgctttgaagctgaatgccctggat
gtcacagatacagggccatatacctgtgtggcagccaatgtggctggatctgatgaatgc
agtgccttcttgactgtacaagaaccaccttcttttgtgaagacacctgatccccaggaa
gttttgcccagatcaagcgtgacattcaccagctacatcaagggcagtactcccttcaaa
gtgacctggtttcgaggcatcagggagttggtgccggacagcaactgctccatctctctg
gatgagtctgtggcacagctgcagctatacaatgtggagccaggccacagcggggactac
gcttgcgtggtcacaaatgatgctggcagtgcctcatgcacaacccaactctttgtgaaa
gagcctgcagtctttgtgaagaaattaagtgatttcagcgtggagcaggggaagtccatt
gtgttggaaagcagctacacaggcacccctcccatctctgtcacttggaaaagaaatggc
atgcccattgctcagtctccacgctgcagtgttacaactactgacaaatgtggcattctt
gaaatctttaacagcaccaagagcgatgaaggcgaatacacctgtgaggtggcaaatgag
gcgggtggggatgtttgccacagccttgtatccatcttagaaccaccctattttgtcacg
cacctggaccgtgtagaggtgaaagttggggagcccttggtcttaaaatgccagattggt
ggtgcgccagaaatcaaggtgtcctggtacaaagacgacaccaagctcagatcaacacag
gcttacaaaatgcacttgaagaacaatgtggcgacgctggcattctccaccgtggaggat
agtgacattggagaatatatctgcaaagcagaaaatagcgttggcttcgccacttccaca
gctttacttgttgttaaagaacgtcaacttcctcctacattcaccagaaaactgaaagat
attcaggaggcagttggtgccccagtgacatttgattgccgcataaatggctcagagcct
atccaggtgtcttggtacaaggatggggttctcttaagtgacagtgataacatgcaatca
gccttcttaaataatattgcgactctccagatcttgcaaactagtatggctcactgtggt
caatatacttgctcagctcaaaatgctctgggtactgcatcttccagtgccaaacttgtc
ctcacagaacatctacaacctcccttctttgacatcaagccagtacctatcaatgtggca
cgaggggaaagtgcaacctttaagtgccacatgactggctctgctcccatgaggattact
tggaccagagacaacagagagatacgcccaggtggcaactacaagatgacgttggtggaa
aacacggccagcttgacagtcttaaacgttggtaaaggggatgctggactttacacatgt
actgcgagcaacagtgttggaaaggatgcatgtgcagctcagctggctgtacaagaacca
ccaaggtttattaagaaactggactcctccagacttgtgaaacagcatgattccactaag
tatgaatgcaaaataggtgggtctccagaaatcaaagtcacctggtacaaaggtgatacc
aagatccatcccagtgaaaaatacagaatgtcctttgtggattcggtggcagccattgaa
atgcacaacctcagcgttgaagacagtggtgactacacttgtgaagctcagaatccagcg
ggtagtgcaagcaccagtacctcactgaaagtaaaagcaccccccatttttaccaagaag
ccccatccagtccagaccttgaaagggtctgatattcaccttgaatgtgagcttcagggc
actcctccattccagatttcatggtataaagacaaacgagaaattcggagcagcaagaag
tataaggttatgtccgagaactacctagctagtattcacattcttagtgtggatactgga
gatgttggtgaatatcactgtaaagctgtaaatgatgtgggaagtgactcctgtattggc
tctgtaacactaagagcaccaccgtcctttgtgaagaagctgagtgatctcactgtcgta
gttggggagtcaattgaactgcaggctgcagtagaaggatcacagcccatttctgttctg
tggttaaaagacaaaggggaaatcattagagaaagtgaaaatctttggatctcctattca
gaaaacattgcaaccatgcggattggaaatgcagaaccagccaatgctgggaaatacgtt
tgtcagataaaaaatgatgctggagttaaggaatgttttgccacgctgacagtgctagaa
cctgcagtcattgtagagaagccaggcccagtcaaagttacagctggagactcttgtact
ctggaatgcgcagtagatggcacaccagaacttactgctaggtggtttaaggatggaaat
gaattgtccactgaccataaatataaaatcagtttcttcaacaaagtatctgggcttaag
atcctcaatgcaagactagaagacagcggagaatatacttttgaggtgaaaaacagtgtt
ggtaaaagcagctgcacagcttcagtgcatgtttcagatcgtattatacctccttctttc
acaagaaaactgaaagaaacatacggtcagctgggttcttctgccgtactggagtgcaaa
gtttatgggtcaccacctattctggtttcctggtttcatgatggacaggagattaccagt
ggagacaagtatcaggctacccttacagacaatacctgttctctaaaagtgaatagactt
caggaatctgatatgggaacttatttgtgcacagctagtaacgtagctgggtctgatgaa
tgcagcgcatttttgagtgttagagaaccaccatcttttgtgaagaaacttgaaccactg
aatgttttatctggggaaaacataacctttaccagtatcgtaaaaggctcccctccactg
gaagttaaatggtttagaggtagtgttgaactagtaccaggagaaagatgcaacatcacc
ttgcaagattcaattgcagaactggagctgtttgatgtacatccacttcagagtggagac
tacacctgccaggtctccaatgaggcagggaagatttcttgcacagcacatctttttgtc
aaagaaccagccaaatttgtgaagaaggtgaatgatttaaatgtagaaaaagggaaaaat
ttaatcttggaatgcacatatacgggtactccaccaatttcagtaacatggaagaaaaat
ggagtaaaaataatgcactctgagaagtgtaacatcaccactacagaaacatctgccata
ctggaaatctctagtagcaaactagaagatcaggggcaatattcttgtcatattgaaaat
gattctggacaagacaattgtcatggtgcaatcacagtactagaaccaccttacttcatt
acacccttggagccagttcaggtgactgttggggattctgcatccttacagtgccaggtt
gctggaacaccagaaatgattgtatcatggtacaaaggcgatacaaagttgagaggaact
gctaccgtgaaaatgcattataagaaccaagttgccactctggttttcagccaggtagac
agtagtgacagtggggagtatatctgcaaagtagaaaatgctgttggggaggctgcttca
tcgtctttgctgacagttcaagagcgtaaacttcctccttcttttacacgaaaattaaga
gatgttcatgaaactgttggcttaccagttacatttgattgtggcattgctggttcagaa
cctattgaagtaacttggtttaaagacggtgttcatttaaaagaggactacaatgttcac
acgtcctttgtggataacgtagcaactctccggattttgaagacagataggagccttatt
gggcaatatacctgcacagctaccaacgcgattgggactgcttcttctagtggcaggctt
gtccttacagaagggaagactcctccattctttgacatcccaattacacctgtggatggt
attattggagaaagtgctgactttgagtgtcacatttctggaacacagcccattagagtc
acttgggcaaaagataaccaagagattagaacaggaagaaactaccagatcagttatgta
gacaacactgctcacttgaccatcttgagtgttgacaggggagactctggaaagtataca
tgctatgctagcaatgaagctgggaaggactcttgcacagctcaactgaatgttaaagaa
cgaaaaactccacctacttttactaagaaactgtctgaagcagtagaagaaacagaaggg
aatgaacttaaacttgagggccgtatttctggctctcagcctttgactgttgcttggtat
aaaaacaatcaggaagttcattcaagccctcattgtgaaatctctttcaaaaacaatacc
ttacttttgcatataaagagtgtagagcaatcagatgctggtttatatacctgtaaagtg
tccaatgaagcaggaagcgtgttgtgtacatcttctgttgttatcagagaacctaaaaaa
cctccagtttttgaccagcctcttcagccaacagcagcagcagaggaaggtgatacccta
catctcagctgccatgtccaaggatcacagccaatccggattcagtggctgaaggcaggg
agagaaataagagcttcagacagatgcaacttcagctttgctaatggagtagctcttctg
gaacttgctgcagttatcaaatccgattcaggagaatatgtatgcaaagcttcaaatgca
gctggcagtgatacttgcaaatctaaagtgacaattaaagaaaaaccatcagctgcacca
gcggctaagaaagtagaagtggaaggaaaactttattttgtgacagagcctcagaatatc
aaagtcatggaaaagactgttgcaaaatttattgcaaaagttggaggagacccaattcca
aatgttaaatggatgaagggaaagtggaggcaactcaaccagggaggtcgcattataatc
cagcagagaggagatgaagccaaactagaaataaaggatgcaataaaaactgattctggc
atgtataaatgcgtagcttttaaccaacatggtgaaattgagaggagtgtaaacctacaa
gttgaagaaagaaagaaagaagaagttgttgaaggggatctcagggcaaaactaaaaagc
actccaacaaaaaagaaggaagaagaggaacaacctattgatatcttggaacttctcaaa
aatgtagatcccaaagaatatgagaaatatgctcgcatgtatggaattacagatttccgt
ggcctcctgcaagcatttgagttattaaagcaaacccaagcagaagaaagtcatagattg
gaaattgaactcacagaaaaagctcaaagagaagatcaggagtttgatgaacttgtagct
tttattcagcaacgactctcacagacagagcctattactctgatcagagacattgaaaac
cagacggttttaacagatgaggatgccatctttgaatgtgagattaaaattaattatcca
gaaattaaactttcatggtacaagggaacccagaaactggactccaatgacaaatatgaa
attagaattgaaggtgatcaccacatactgagaatcaggaactgccaacttgaggatcag
ggaaatttcagaatagtgtgtggaccacacattgccagtgccaggctaactgtcattgaa
cctgcagttgaacggcatcttcatgacaccactttcaaggaaggaaacatatgcacgctg
tcttgtcaattctctatcccaaatgccaagtctcagtggtatagaaatgggagacccatt
aagataggcgggagatattcaacacaagtctctgataaagtacacaaactcatcatcaag
gatgttagaacagaagaccagggacaatatacctgcaggcttgacaatctagaaacaact
gcagatctggccattgaagcggaaccaattcagttcacaaagagcatacagaacattgta
gtgagtgaacaccagtctgcaacctttgagtgcgaggtgtcttttgatgatgcagttgtg
acatggtataaaggccccactgaactgagagagagtcccaagtacagcttcaggagtgaa
ggtcgctgtcactatatgactattcacaacgttactgcagaagatgaaggtgtgtattct
gtaattgctcgtcttgaaccaagaggagaagcaagaagcactgcagagctctatctggta
accaaagaaatcaaactggagttgaagccaccagatgttcctgatgccaaggttgcagtt
ccacctcaaaaaccagctgaagctgctcctattcctattcttctacctcttgttccacca
ccagtggagaaaaagccagcagaaaaaaaggttccagtaaagaaagtctccaaaaaggtg
gttaaaaaaggtcctgaagaagtcccaccacctaaagttcctgaggtgctgccagagaag
cccaaagagatcaaaataacatccatggcaaggagagaagagatttatgaagaaaagaag
gaaatatatgaaaagcccaaagaaatttatgaagaatgggaagaagattatggcgaagac
catgactattatgtcaaggaagaaggctatgatgaaggggaagaggaatgggaagaagct
tatgagaaaagagaagtgagctatgaagagaaacgagtcattcatgaagaagtggttgaa
gttcctaagaagcctgtgcctgagcgaaaaccaccaacaattacagctgaaaagaaggaa
aagaaagaagtaacagttcgtaaagttgtcaagaaacctgttgatgaaaaagtggagata
accactcagagggttggtgaagaaaaagtcaaacgggctgaggttaccaagaaagttgta
ccaccaaaacctacaccaatgatcattgaggaaaaagttgtgaaaaaggaagtaccgaca
gtagaaacatggactgtttcagaagaaaagatgtcggtttctgtccacagagaagaagag
tattcatatgtcacagagccaacagagcatgagaaaacagttgaagaaagattctttgaa
gctgtttacccaattgaagcacataaggaagtcgaagaggaagaggaagaagaagaagaa
gaagaagaaatttctacagaagtggagatccctcacactgaagtgcctgagataccaaag
aggcatattccagaagaaagaaagcctgttcctgtccctaaaaaagaagctccaccagct
aaagtgcctgaagtccctaagaaacctgttccagaaaagaaagttgctgttgctaaaaag
gaggtggctcccccagcaaaagtgcccgaggtgcctaagagagctcccccagagaaaaaa
attgcagttccaaaaagagaggaagctccagcacctaaagtgccagaagtacctatgaaa
ccagctccagaagaaaaaataccccatgttcctaaagtagaagctccacctgccaaagtg
cctgccgttcctaagaaacctatccctaaagagaaagtacctcctgctgttcctaaaaaa
gttgaggctcctccagctaaagtgcctgaagtacacaagaaagccacttttgaagaaaga
gtacttattacagaagaaagaatatctgttgccattccagaagaaatcccaccacctgaa
gaaccaacagttgaagaatgggctgaagaagaaatagaggaatcatctatttccattcac
agagaagaggtttctgaagtgactgaagaagagtcttactacatagaggagcgggtaact
gttcctaaaagagaggaagccccacccactaaagtgcctgagaagcataggagagttgtc
cctgaacggaaagttccagctgcccctaaggaagctccagcagttaaagttcctgaagtt
cataagaaagctgttcctaaagagaaagtacctgtccctgtgactaaaaaattggaggct
ccacaagcaagagaacctgcagaagaacgggtgcccacttttgagatagaagttgaagaa
cctccatcaaccagagtgactgaagtgcacagaaaaattatcacagaagaaaaagttgca
gttgctaaaaaagaggaggctccaccgaaaagagcagtgcccaagaagcctgtgccagaa
gaaaaagtacctgttccaatttcacagaaagtggcagctccaccacctaaagtcccagaa
gcaccaaagaaaattgccagacaagaaagagtatccattgctgttccaaaaagaaaagtg
tctccaccaccagaagtaccaacagaagaagaacactgggctatgtcagaggaagtatcc
atttctcttcacacagaaaaggagatttcatacacagtgcctgatgtaccagagagggct
attattgaagaaagagtaccagtttatcctcctaaaaaaatggcaagaccaccagccaaa
gtgcctgaaatgcgcaagacagttgtccgaaaagaaaaagtatatgttgaagttcctcag
tatgaagaggaagaagagattccaacatatgaagaagaagaagccaccagatatgaggag
gaagtaatccattacaaggaggaagtccaccattatgaagaagttagtcactacgaggag
gaagttcctcagtatgaagaagttcctcaatatgaagaggaagaagtcacccattatgaa
gaagcagctgcttattatgaagaagttcctgaatatgaggaggaagagccagaagttccc
cagtatgaagaggaggctcccccacgagttagagtgcctgaggttcccaagaagcctgtt
ccagaggaaaaaatacctattctgaagaaaaaagaagctcctccagcaaaagttccagaa
gtgctgaagaagcctgttccagaagagaagattcctgttcctgtaccaaaaaagaaggaa
gttccaccagccaaagtgcctgaagtaccaaagaaacttgtgccagaagagaaggtactt
gtcccagtgcctaaaaaagtggaagaacctccaccagccaaagtgcctgaagttcccaag
aaagttccagaaaagaaagtaccagtccctgtatataaaaagccagaacctccaccagcc
aaagtcccagaggtgcccaagagagctgtcccacaagaaaaagtacctgttgcagttcct
aaagtaaagaaaattccaccagctaaagtacctgaggtgacaaagaaagttgtgcctgaa
gaaaaggttcccatttttgctcctgaggaagaagaagaggcaactattccagaggaaatt
ataccagcaaaagtgccagagattcctaagaaacctatctctaaagaaaaaatacctgta
cccactcctgagaaaatggagcttcctccagcaaaagtgcctgagatgcctaagaaactt
gttcctgaagagaaagaacctgttcctaaaaaggtgccagctccaccagccaaagtaccc
aagatgcctaagaaggttgttcctgaagagaaggtgcccgttgccgaaaaagtggaggtt
ccagctgcaaaagtccctgaggtgcgtaaaagagctgttgcagaagtgaaggtgccagct
gttgtgcccaaacccaaagaacctacaccaactaaagtgtccgaagtatccaagaaactt
gtccggaaagaaaaagtccctgctcctgctcctgtggtggagaagtatgagtatgcatat
gaagagtatgagaagtacgagacatatgaaagtattggagagtttgagaaagttcaggaa
actgaagaaattgaggcatatgaggaacccgaagaacctgagagatataaggagattcag
gaacaggaatatgaagaggaggctgaggagaaagaagatttctatgaaaagtatgagttt
aaggagaaggaagagatctgtgagaaatatgaggaggtgtatgaggagacttacgaaatc
caaccagctatagtgcctaaggtgcctaaaagacctgtgccagaagaaaaagtacctgtt
cctgttcttaaaaaagaagctccaccagctaaagtgccgaagaaacctgttccaaaagaa
aaagcaccatctgctgttcctaaaaaggaaatgcctccaccagctaaagggccagctgtt
cccataagaactgtccctgaagaaaagaaacctacatatgcacccgaaatagaagttcca
ccaatgaaagttcctgagttccataagagagctgtccttgaagaggaagtattcaccatt
atttctagagaagaggagcctcgtttgtatgaagatgttatgtgtctgtcattgctcttt
gttgcttacattttgtacattgtaatgttctttaaaaaatacaatatctttgaagtacct
gcagtgccaaagaaaactgtccctccgaagaaaatacctgctgctgtacctacagaagaa
gctcctccagctaaagtttctgaagtaccaaagaaagctgtccgcaaagaaaaaatacct
cctgctctacctaaagaagaagcttcgcatcttaaagtacccacagtcattaagaaagct
gttccagaagaaaaggtgcctactactgtgcctaaaaaaacagaacctactcctgtgcct
aaaaggccagaatctccaccatctaaagtgcctgaattgcccaagaaaactatccctgaa
gagaaacctgtccctctgcctaaaaagccagaagctccacctgccaaagtgccagaggtg
cccaagaagattccagaagagaaagtaccaattgctgtgcctagaaaaccagcaccacca
gcagccaaagttcctgaagcacccaaggaagtagttgtagaagagaaaatcaaagttgct
gtgcctaaaaagccggaagtaccaccagctaaagtgccagaagtgcccaagaaagtccca
gatgagaaaatactagttgcggagcctaaaaaaccggcagttccaccacctaaagtgcct
gaggtaccaaagaaagtggtcccggaagaggtttcagttaaagtaccaaagaaaccagaa
cctccaccaactaaagtgcctgaagagcccaagaaagtggtttcagaagaaaaaatacac
gttgcagttcctaaaaaagcagaacctccgccacctaaagaacctgagatgccgaagaaa
gttgttccagaaaagaaaatacctgtgcctaaaataccagaacctgaggttgtgcctaaa
gaacaagaacctgtggttgtcccagaaccagaggctgcacctgaagaaccagaacctcta
ccagagaaagtggccaagacaactttgccagaaaagaaagtagctgttccagtttctcaa
aaacgaaagcacactgcagaaccctcaaaaccaaagcctcaagaagtagaacctcaagaa
ctggaacctactagagtggcccgaaaacaaaagcctgttacagcaccccaaaaactagag
catgttgtggcatccgaggagcctgagactgttttggcatcgcaaaaaccagagcgtgtt
gtggtgcctgagaaaccagagtccattgtggtacctgaggaacccaagcctgatgtggca
tcccaaaaaataaaacacagtgtggtgtccccaaaacaaaagcctgttgtggaaccccaa
aaaccaatgcatgttgtagtacctgagaaaccagagtttgttgtggtacctgaggaaccc
aaactcgatgttccaccccaaaagctaaagtatggtgtgatgccctcaaaacaaaagcct
gttgtggaaccccaaaaaccaatgcgtgttgtagtgcctgagaaaccagagtttgttgtg
gtacccgaggaacccaaactcgatgtgccaccccaaaagctaaagtatggtgtgatgccc
tcaaaacaaaagcctgttgtggaaccccaaaaaacagagccattcatggcctctgaggaa
cctgagctcactgtggcacctgaggagtcagaggaagttgctttaacacaaaaatcagag
tatgttgtggtgccccccaaaacaaaaccttttgtgccaccccaaaaaacagagtttgtt
gtagcacatgaagaaacagagtttgttgcagatttccaaaaatcagtgcgtattgcagta
tccagaaaatcgaagcctgctgtggcatcctgcaagccagaaccgtttacggtgcctgaa
gaaccagaaccaattttagcaccccaaaaactacagccttctagggtgcttcaaaaacca
aagcctgaagtggcatctgaagaaccagagcctgttttgccacctgaggaaccaccacca
gccgagctggccaaaaagcaagagagtgttgctatacctaaaaaacgagcagctccacga
tctaaagagccttcaatgccggaaaaagctgtcccagaagagaaaattcatgtagctctt
cctgaaaaaccagaacctccatcagtcagagtgcccacaaaactaaaatatactaatatc
tttgaagtgcccaaggtgcccaagaaaagtgttctggaagagcccatacctgtaactgtg
ccaaaaaagccagaacctgcaccagttcgagcacccgaggtgcccaggaaggctactcgt
gaggaaaaagtacctgtggccattgccaaagcaccagagcttccagcacccagagtgcct
gagatgcctgaggcagaggtcccagaagaggaagaggaggaggaagcaccgccggagatg
acaccagttgctgagcctgtagaaccagaagctcctccagctgaagtgcctgaggtggct
gaggaggaagagctggaagaggaggtgccagcgatcattcccccaaagcctgtggctgta
cccaagaaggctgtggctgtgccaaagaaaccagaagctccaccagctaaagtgctcaag
gtgcccaagaaagctgtcctgcaagaaaaaacgcccgttgctgcacccaaaaagccagaa
ctaccactagccaaagtgcccaaggagcccaggaaaagtgttctggaagagcccatacct
gtaactgtgccaaaaaagccagaacctgcaccagttcgagcacccgaggtgcccaggaag
gctactcgtgaggaaaaagtacctgtggccattgccaaagcaccagagcttccagcaccc
agagtgcctgagatgcctgaggcagaggtcccagaagaggaagaggaggaggaagcaccg
ccggagatgacaccagttgctgagcctgtagaaccagaagctcctccagctgaagtgcct
gaggtggctgaggaggaagagctggaagaggaggtgccagcggtcattcccccaaagcct
gtggctgtacccaagaaggctgtggctgtgccaaagaaaccagcagttgtgcccaagaaa
ccagagcctgtgactgtaccaaaaataccagagcctgtgcctgttcttaaaaaacataaa
gttccttcagttaaagtgcctgaggtgcccaagaaacctgtcccagaggagaaagtacct
gttgctgttcctaaaatacctgaaccactaccaagtgaagaatatgaaattgtaaaggag
attgagcctgaagaagcagaagaaattccagctgcaaaaatagaagaagctttaccagct
gaagcaccagaacctgaaaagaagatccctgaaaagcgaaaaccaccaccacttactgca
ccaacagaagatattaaattggcaaaagaactacttaaagctcctggatcaaggaagaaa
gttgtgactgcaaaacctggtgagcctccagaattggaacccccacctgctaaagtgcct
ggacttgtaaagaaacctcgcagagtgattcctgaagttgctcctccaccaaaagaagaa
gttgttttgaaaagagttcttaaaaagaaaacagaagaggaagaacctaaaccagaaaaa
gaacctaaaccagaagttaaaccagtacctaccccagcagaaaaaattaagaaacctgaa
gtcccagaggttcctaagaagaaaactgagatacctgtcataaaaaaagaggagaaatat
gtgccagagccaccaaaagagcctaagcaagcagctatcccacttcctgggcctgaacct
aaacctgcagtagctctaaaatctccaaaaccagcagcagaaccagcaccagctgttact
actccagtgacagtcccagtagttggaaagaaagcagagcccaagccaccaaaagaggaa
tcaccaaagggtatcagtccagtcaaaggtaggatatgaaagacaccttcaccagcagat
gcagaaagaaggaaactcagaccaggaagcggtggtgaaaaacctcctgaagagccgcca
ttcacttaccaactcaaggctgtaccactgaagtttgtcaaggagatgaaagatatagtg
ctaacagaagctgaatctgttgggtcttctgcaatctttgaagtccttatttcaccatcc
actgcaattaccagctggatgaaagatggaagtaacatccgagagagtccaaaacacaag
tttattgctgatggcaaagatagaaagttgcatattattgatgtccagctgtcagatgct
ggtgaatatacttgtgtattacgactggggaacaaagagaagacatctacagccaaactc
attgttgaagaactcccagtacggtttgtgaaaactcttgaagaagaagtcactgtggtt
aaaacccagccactgtacttgacatgtgagcttaacaaagaaagaaatgtggtctggagg
aaggatgggaagatcatcaaagacaagcctgggaaatttgctctgggcattattggtttg
tcacattccctcacgatcattgattcagatgatgctgatgctggcacttacagtgttact
gtggaagacactgagctgtcatgttcatcttgtgttaaggtagtagaagtgataagagat
tggttagtaaaacctataagagaccaacatgtgaaaccaaaaggaacagctactttcacc
tgtgacattgtcaaggatacaccaaacattaaatggtttaaaggagatgaggaaatccct
gctgaaccaactgacaagacagaaatcttgaaagaaggaaataaaattttcctgaaaatc
aagaatgctggccctgctgatattggggaatattcagtggaagttgaaggtcgcagatac
ccagctaaactgacccttggtgaacgtgaagttgaacttctgaagccattagaggatgtt
acagtttacgagaaagaaacagcaaactttgatacagaaatatcagaggaggatattcct
ggtgaatggaagctgaaaggagaaattctgagaccctcacctacatgtgaaatcaaagct
gaaggaggaaaacgcttcctaaccttgcacaaagtcaagttagagcaagctggtgaagtc
ctttaccaggcacttaatgcgtttactacagctatcctgacagtgaaagaaattgaactg
gactttgctgtgcccctaaaagatgttactgtccctgagaggcgccaagcaaggtttgaa
tgtgtccttaccagagaagccaatgttatatggtctaagggcactgatatactcaagatt
ggagaaaaatttgacatcattgccgatggaaagaagcatattcttgtaatcaatgattct
cagtttgatgatgagggagaatacactgctgaagttgatggcaagaagagcacagcaaga
ctgtttgtggaaggtgtgaggctgaagttcatatcacctctacaggatcaaacagtgaaa
gaaggggaaacagctcactttcagtttgagctttctcatgaagacatgccagtgaaatgg
tataaaaatgagaaaagacttcacacaagcagaacagtttttatgacttcagaaggcaaa
gttcataaactagaaatgagagaagtaacacttgatgatatctccgaaataaaggccgta
gtcaaggacttgaacacacaagcaaacctgaaagtcttagaggccgatccatatttcact
gtgaaattacaagactacagtgctgtggagaaagatgatattattctggagtgtgaactt
agcaaagatgtgccagtaaaatggtacaaagatggtgaagaactagtagcttccaacaga
atttccataaaaacggatggattgcgccgtatcctgaagatcaagaaggctgcagagagt
gataagggtgtttatgaatgtgactgtggaaccgacaagacaagtgctaatgtcagcgtt
gagcctcgcttaattaaagtggagcgaccactgtatggagtggaagtatttgttggtgaa
acagcacgttttgaaattgaaatttctgagcctgatgtccatcctatatggaagctaaag
ggagaaaccctaacaccttcacctgaatgtgaaatcattgaagatgggaagaagcatgcc
cttgttcttcataactgcaaacttgatatgactggagaagtgtctttccaagctgctaat
gctaaaagtgctgccaatctgaaagtgaaagaattgcctctcatctttatcactccacta
agcgatgtgaaggtctttgagaaggatgaagccaggtttgaatgtgaggtgtccagagaa
cccaagactttccgctggttgaaaggaacacaagagatcactcctgatgaaagatttgaa
attatttcagacgggacaaagcatgctctgattattaaatctgttgcatttgaggatgaa
gctaaatacatgtttgaagctgaggataagataacaagtgccaagctgattattgaaggt
atccgcctgaaattcattactcctctcaaggatgtaacaaaaaaggagcgagaaactgca
gtttttactgtggaactgtcccatgaaaatatccctgttatctggttcaagaatgaccag
cgattacataccagcaaagtggtttcaatggcagatgatggcaaattccatacactcaca
atcaaagaccttactattgatgatacctctcagattaaagtggaagctatgggcaaatcc
tcagaagctaaactcactgttcttgagggagatccttatttcactgggaagctgcaagat
tacactgctgtagagaaagatgaagtaatcttacaatgtgaaatcagcaaagcagatgcc
ccagtgaaatggatgaaggatggcaaaccaattactccatcaaagaatgttgttattaag
gctgatggcaaaaagagaatccttatcctcaagaaagctttgaagaaagacattggacag
tacacttgtgactgtggtactgatcaaacctctgctaaactcaatattgaagaccgggat
attgagattatacgtccactatacagtgtggaggttgttgagacagagactgcccgtttt
gatattgaaatctccgaggaaggtgtccatggcaattggaagctaaaaggagaacccctg
actgaatcagctgaatgtgaaatcaaagaggaaggcaaaaagcacttccttacactgtac
aatgtacgcttagatcaagctggtggagtagatttccaagcagcaaatgccaaatccggt
gctcaccttcgagtgaaacctcgagtaattggcttgctgagacccctcaaggatgtaaca
gtgacagctggggaatcagcaacttttgattgtgaactctcttatgagggaatccctgta
gagtggttcctgcaaggaaagaaactggagccaagtgataaggttgtgacacgtgctgaa
ggcagagttcacactcttattcttagagatgtcaagttaacagatgcaggagaggtatca
ctgacagcaaaagatttcagaactcaagcaaatctttttgtgaaagaacccccagttgaa
tttactaaaccacttgaggaccagactgttgaagaggaggccactgcaatactggaatgt
gaagtttccagggaaaatgcaaaagttaaatggttcaaaaatggagaagaaattcacaaa
acaaagaagtatgatatcatttctgatggcagggtcagaaaactcattatctatggctgc
acactggatgacgcaaaaacatatacctgtgatgccaaggattttaagacatcatgtttt
ctcaatgtagaacctattcgtgttgagttcctgaaacccctaactgaccttgaagttaaa
gaaaaagaatctgcccggtttgaatgtgaaatttctcgtccaggtgtcaaggtgaagtgg
tttaaggatggcattgaaattagaaaaggcaaaaagtatgacataatttcccaaggtgca
aaacgcattcttgttgtgagtaaatgtgccttcgatgatgaagctgagtatgcctgtgaa
gcaaaaacagctcgaacttctggcctacttacagtgatagaggaagaggctgttttcaca
aaaaatcttcctgatcttgaagtaaatgaaaatgacactgtaaaactgatctgtgaagtt
tcaaagcctaatgctgaagttacttggtttaaaggagatgaggaggtgcctgatggtggt
aggtttgaacatattactgatggccgaaagagaattcttatcatacgtaatgctcatcct
gaagatgctggcaaatatacttgcaagctcccaagctctagtacaacaggaaaacttact
gtacatgaacttgcagcagaatttcttaccaaaccacaaaatcttgaggtacttgaagga
gacaaagctgaatttttctgttcagtatccaaagaggcaattacagtacagtggctgaga
ggtgacacagtcctggaacctgatgataagtacgacatcatttcagatggcaaaaagaga
acacttgtggttaaagactctattctaggagatgcaggaaaatatactgtcatggttggt
gaagctaaagctacagcacgcttaacagtgattgaaaaactcaggattataactcccctt
aaggaccaagaagttaatgagggtcaagaaattatcttcaactgtgaagtcaataaagaa
ggtgccaaagagaagtggtacaaaaatgatgaggcaatatttgatagtgcaaaatacatt
attgtccagaaggatttagtttacactctccgaattagagacgcacagttgaaagatcaa
gctacctataccatctcactgtcaaacaagagaggtgaacatgccaaaagttctgctgcc
ttgacagtactagaggaggatctcaggattattgaaccccttgaagacattgagaccatg
gaaaagaaaactgtcacattctggtgcaaagtgaatcgccttaatgcaaccctcaaatgg
acaaagaacggtgaagagatcacattcaacaagcgcattttgtacaaaattgataaatac
aaacactcactcatcattaaagactgtgggtttgtcgatgaaggtgaatacactgttact
gctggacaagacaaatctgttgcagaacttctaatcacagaggcaccggcagacttcatt
gaacacctccgggaccagactgtcactgaatttgatgatgctgtctttacatgccagctt
tccaaagagaaagccagtgtaagatggtacagaaatggaagagaaatcaaagaaggcaag
aaataccaatttgaaaaggatggaaatttgcacagattaatcataaaagactgtagactc
gatgatgagtgtgaatattcttgtggagtggatgacaggaaatctagggcaagacttttt
gttgaagaaatccccgttgagatcattcgaccaccacaagatatttatgaagctcctggt
gcagatgtcatcttcatggctgaattgaataaagatggtgtggaggtcaagtggttgaga
aacaatatgattatcgtccaaggtgacaaacatcagatgatgagtgaaggaaaggtccac
aggctacaggtgtgtgagataaagccccgtgaccaaggagaatacagatttattgccaaa
gataaggaagctagagctaaacttgaattagctgctgcacctagaatcaagactggtgat
caaaaccttgtggttgatgttgggaagcctctgactatgactgttccatatgatgcctac
ccaagagcagaagctgaatggttgaaaggggaagaaagtctgcccacaacaacggttgat
acaacaactgactgcactaccttcaaaatttatgaagcaaagaaatcagataagggaagg
tacaaggttatactccgaaacaaacatggccaggcagaagcattcatcaatgtagaggtc
attgatgttccgggcccagttagaaacttggaagtcaccgaaacttatgatggtgaagtt
ggcctcgcctggcaagaaccagaaagtgatggtggaagtaaaataataggctacgttgtt
gaaagacgtgatatcaagcgtaagacctggattacagtcactgatcgtgctgaaaattgt
gaatacattgttactggacttcaaaaaggaggagttgaatacctcttccgtgttagtgca
cggaacagagtgggcactggtgagccagtggaaacagagagacctgtggaagctaagagc
aaatttgatgttcctggtcctcctcaaaatgtagacgttaccgacgtgaacaggtttgga
gctacacttacctgggaaccacctgagtatgatggaggatccccaattactggctacatt
attgaactgcgtaacagaggttccatcagatgggagccaactatgaccactggagctgat
gaactgtcagctgtcctaactgatgttgtagaaaatgaagaatatttcttcagagtaaga
gctcaaaacatggttggagttggcaaaccaagtcctgctacacgtgcagtaaaaattatg
gacccaatcaagagacccagtcctcccattaaccttgatcattcagatcaaactaagtca
tcagtgcagctcacatgggagcctcctctcgaagatggaggaagtccagtcttaggctat
attgttgaaaggcaagaagaaggaacagacaagtggattcgctgtaacccaaaactagta
cctgctcttacttataaggtaactggtttgaaaccaggatccaggtattactacagagtc
tcagcagaaaatgcagctggtgtgtctgacccagcggaggctattggaccattaactgca
gatgatacttttgttggacctacaatggacctaagtgcttttaaagatgggctggaagtt
attgttccagagccaatcaagatccgtgttcctatcactggctaccctgtgccaactgcc
acatggtcttttggtgaccaagtcttagaagagggcgatcgtgtaacaatgaagacaact
gcctcctttgcagaactagtaattactccaagtgaacgtccagacaagggaatttattcc
ttaacattagaaaaccctgtgtcatctgtttcaggagaaattaatgttaatgtcattgct
cgtccaagtgcaccaagagaacttaaagttttagacataatcaagaacacagtgcagcta
tcatgggaacctccagaagatgatggtggaagtccagttactggctatataattgaaaaa
cgtgaagtaagccggaaaacatggagcaaagttatggatcatgtagttgaccaagagttc
actgtacctgacctcatccaaggaaaagaatatttatttagagtttctgcatgcaataaa
tgtggcccaggagaacctgcatatattgatgaacctgtaaatatgtcagcaccagcaacg
gtgcctgatccaccagagaatgttaaatggagaaatccaacatcaaaaggaatcttccta
acctgggagcctcccaaatatgatggtggtgcccgcattaagggttatctggtagaaaaa
tcccaacgtggcacagacaagtgggagatatgtggggagcctgttgttgaaacaaaaatg
gaagttacaaaactcaaggaaggagagtggtatgcatatcgggttaaagctttgaataga
ataggagctagcaagccaagtaagccaacagatgatattcaagccattgatgcaaaagag
gctccagaaattttcttagatgtgaaacttcttgctggacttactgtgaaagctggaact
aaaattgagctgccagctaaagtaactggaaagcccgagccccaggttacttggaccaag
gctgacaaaattttgagacctgatgacagaatcaccattgaaaccaaacctaatcattct
acagtcactattacagacagtaagaggagtgacagtggaacctatattatagaagctgta
aattccagtggacgtgctactgctgttgttgaagttaatgttcttgataaacctggccca
ccagctgcatttgatgtatcagaaatcacaaatgaatcctgccttctgacatggaatcct
ccacgagatgatgggggttctaaaattaccaactatgtccttgagaaaagagctacagat
agtgaaatatggcacaagttgtcatcaactattaaggatacaaaattcagagctaccaat
ttaactcctcataaagaatatgtgttccgagtcagtgctgagaacatgtatggtattggg
gaaccagtagagtgtagccccatcattgcaaaatattcatttgatccaccaggccctcca
acaggtctcaagcctacagaggtcactaaagactcagtgaccttaacatggaatgaacca
gatgaagatggtggcagccccataactggctactgggttgaaagatatgatcccgagcag
gataaatggataaaatgcaataaaatgccagtgaaagatacgacatttaaagttaaaggt
cttacaaataagaagaaatataagttccgtgtcttggcagagaatcttgcaggacctgga
aaaccaagcaaggaaacagaaccaatcctagtgaaagacccaattgatccaccatggcct
cctggaaaaccaactgtgaaagatgttggcaagacgtcattattcctgaactggacaaag
ccagaacatgatggaggggcaaagattgaatcttatgtcattgaactactaaagactgga
acagatgagtgggtgagagtagctgaaggcgttcccacaactgaacacttcctcaaaggg
cttatggagaaacaagaatattcattccgtgtaagagctgtgaacaaggctggcgaaagt
gagcccagtgaacccagtgaccctgtgctgtgcaaggagcggctctatcctccttcaccg
cctcggtggcttgaggttattaatattactaaaaacacagcagatcttaaatggactgta
ccagaaaaagatgggggttccccaattaccaactacattgttgaaaagagagatgtaagg
cgaaaaggctggcagacagttgatacaacagtgaaagataccaagtacacagtgagccca
ctgacagaaggctcattgtatgtgttccgtgtggctgctgaaaatgccattggacagagt
gattattgtgaaattgaagattcagtgcttgctaaagatactttcacaacccctgggcct
ccatatgctcttacaatagttgaagtgacaaaaggccatgttgatttgaaatgggaacca
cctaagaatgatggtggcagaccaattcaaagatacgttattgaaaagaaagaaaaacta
gccactcgctgggtaaaagctggcaagacagctggtccagactgcaatttcagagtgact
gatgtcattgaaggtacagatgtacagttccaggttcgtgcagaaaatgaagctggctgt
ggtcatcccagtgaaccaaccgaccttattcatattgaagatcccacaagccctccttcg
ccacctcaggatctgcatgtcacagatgcaggtcgaaaccacatttgtattgcatggaaa
ccacctgagaagaatggtggaagccctattattgggtataatgttgagatgtgtgaagca
ggaacagaaaagtggatgcgaatcaattctcgtccaataaaagatctaaaatgtaaagtg
gaggaaggtgttgttccagacaaggaatatgtgcttcgagtcagagctgtcaatgctgtt
ggagctagtgagccatcagacatctcagaaaaagttgttgccaaggacccagactgtaat
ccaaccattgatctaaaaactcgtgacattgttgttgttaaaggacagaaattacgtatc
cctatacccttcagagctgttccatccccaactataacatggcacaaagatggcaaagaa
ttgaaagctggtgacagaacaacaatgaagagtgactacacctctgcattgcttgaagtc
atagacagtgttcatgctgatgctggtgtttatactatcacactggagaacaaactggca
tcaacaactggctcagtcaatgtcaaagtcataggtccacctggacagtgtaaagacatt
aaagcaagcgaagtaacaaagaattcttgtaaagtatcctgggaacctccagactttgat
ggtggtactcctattctgcattacgttctggaacgcagagaagctggtcgtagaacatat
atcccagtcatgtctggtgaaaataagctttcatggcaagtcaaagatcttatcccaaac
agtgaatattacttccgtgttaaagctgtcaataagattggaggaggtgaataccttgaa
ctaagaaacccaatcattgcagaagacccaaaacagcctccagatcctcctgttgacctt
gaggtccataatccaacatcaaaatcagtaacacttacatggaaaccacccctgtttgat
ggtggaagcaagattatgggctatataatagaaaagctcgctaagggcaaggagaggtgg
gagagatgcaatgaataccttgtacccctattaacttatccagttaaaggtcttgaggaa
ggaaaggaatatcagtttcgtgttcgtgcggagaatgctgctggcatcagtgagccttct
cggattactccttttgtgaaagctgtggatcctattgaggctccaaaagtcttcctggct
gcaaacctacagtctggccttgaggtgaagagaggtgatgagatcatacttgaggcacat
atttcagggtcaccatatccatctatcacttggctgaggaatgatgaagttgtcagacca
gaggaaatcaaaaagagagtaacaacatatacaaggaagaagaagggtgaagttgaagaa
gagaagcctttccagctttcactgccagaacgtatgagtattgacaaccataaagaagga
gaatctgtactatcagttcgtgactccatcagagctgaccatggcacatttacaattaaa
gtagaaaatgatcatggtgttgcaaaagcctcttgtgaagtcaacgtgttagatatacct
gggcctccagtcaactttgtatttgaagatgtgaggaaaaattctgtcatttgcaagtgg
gagcctccccttgatgacggtggaagtgaaatcctaaactatgtactggaaaagaaagac
aatacaaaagctgaaatgggctgggtcactgtcagtgcaacactcagacattgcaaattc
catgtaacaaaactgattgaaggaaaagaatatctgttccatgtatttgctgaaaataga
gttggaccagggccaccatgtgtttcaaaaccaatgatagcgaaagatcctttctctcca
ccagatccacctaataaacccgatgtgcaagatgttaccagcaacagtatgttggttaaa
tggaatgaaccgaaagacaatggcagccctatcataggatactggattgaaaaacgtgaa
attaatagtactcactgggctcgggtcaacaggaaccttgtgaatgctctggaaataaaa
gttgaaggacttctggaaggattaacctacatctttagagtgtgtgctgaaaatgcagct
ggccctggtaaatttagtccaccatcagatccaaaaactgcacaggacccaataatgcca
cctggtccaccgattccaagggttgctgatacaagctcaacttctattgagttagaatgg
gaacctcctgtgtacaatggtggtggagatatcactggctaccatgtatacaaacaactg
gtaggagtaaatgagtggtcacgttgcacagagaaacccattaaggttcgacagtatact
gtgaaagaagtcagagaaggtgcagactataaactccgtgttactgcacttaatgcagct
ggtgaaggaccacctggtgaaactgaacccacaacagttgcagaacctaaagagcctccc
actgttgagctggatgtttctgtcaaagcaggcattcagatcatggctgggcaaactatt
aagattcctgctactgtgactggacgtcctactcccaccattgcatggactgtggaggat
ggtgaattagacaaagatcgagttgttattgaaaatgttggcacaaaatctgagttaacc
attaagaatgcattgaggaaagaccatggaagatatgtaattactgctaccaacagcagt
ggttccaaatctgcaggaaccagagtagaagtatttgatgttcctgggccagtccttgac
ctaaagccagtggtcacaaacagaaagatgtgtttgcttaactggtctgatcctgaagat
gatggtggcagtgatatcataggcttcattgttgaacggaaagatgccaaaatgcacaca
tggagactagctatagacacagagagatctaaatgtgatattacaggtctagttgaaggg
caggagtataaattccgtgttagcgccaagaacaagtttggtactggtccacctgttgaa
ataggacccattcttgcagttgatccactaggtcctccaacagcacctgagaggttcatg
tacacagagaggacaaagtcaagcattacccttgattggaagcctccgcgtagtgatggt
ggcagtcctgtcttaggatacattgttgagaagagaagacatgattcaaaagactatgaa
agagttaatgcaaggctctgtccaacaacatctcttcttgttgaaaaacttgatgaactt
catatgtatgaattccgtgtcaaagctgtgaatgctataggagaaagtgaaccatcattg
cccctaaatgtagttatacaagatgatgaagtacctccaactgttacattacgcttggct
gtgagaggagataccatcaaagtgaaggcaggagaaccagttaacattcctgctgatgtg
acgggtctgccaatgccaaagattgaatgggacaagaatgaagttttaattgaccaaaca
tccagtgcacttaagataaccaaggaagaagtatctagaagtgaggcaaaaactgaactt
attctgcctgcagcagtgagggatgataaaggcacttacactgtgagagcttccaatcgt
cttggcactgcattccgcaatgtgcatgttgaagtatatgatcgtccttctccaccaaga
aatcttgctgtttctgatattaaagcagaatcatgctatttaacatgggatgcacctctt
gataatggtggtagtgaaattacccattacattattgagaaacgtgatgctagtaggaag
aaatcagagtgggaagaagtctccaaaagtgctgttgagagaagatttggggtatggaat
cttgcaacaaatgaaaaatatcaatttagagtccgggctgtaaacaaatacggaataagt
gatgaatgcctctcagaaaaagttgttattaaggatccctatggccttcctggacctcct
ggaaagccaaaaatcttagatcgcaccagatcatcaatgctggtgacttgggaacctcct
ctgaatgacggtggcagcccaataactggttattggctggagaagagagaggtgggaggt
gtctactggtcacgtgttaacagggctccagtaacaaaaccatcagtaaaaggtttacag
tacaatgtgcttcgtttggctgaaggtgttgaataccagttcagagttatggctgaaaat
cttgctggaattggtcctccaagtgaaccatcagatcctgccttagcagcagatcccata
tttgtgcctggtccaccatcttgcccagaggtcaaagacaaaaccaaatcatctgtagtt
cttgcatggaagcctccacaaaaggatggtggcagtcctataaagggatatattgttgaa
atgcaagatgaaggtagtactgactggaagaaggtgaatgagggagacaaactctttcct
acttgtgaatgtgttgttcccaacttgaaagagctcagaaaataccgatttagggtgaaa
gctgtaaatgctgctggggagtcagaaccaagtcctgcaacatcagacatacctgtccaa
gatattctagaggaaccagaaatattccttgatattggagcacaggatttcctctcttgt
cgtgctggcacaacgattaaaattccagctgttatcaagggtcgtccaattccaaaaaca
ttttgggaatttgaaggaaaagcaaagacaacagcaaaggagggaggtcataatgtacct
gaagaagctcaggtggaagcaactgatacacgttcagtgattaccatccctgagtgcaac
agaagtcattccggacgatacagtattacagcaaagaacaaagcaggacaaaaaactgtg
catgtcagagtcaatgtgcttgatgtcccaggcccaccaaaagacctaaaagtaagcgat
atcacaagaggtagttgtaaactttcatggaagatgccagatgatgatggtggagataga
attagaggctatgttatagagaaaagaaatattgatgggaaggcctggactaaagtcaat
gcaaactgtggaagtacatcctttgttgtacctgatctcatatctggccaagagtatttc
ttcagagtacgtgcagaaaaccgttttggtgttggtcctcctgcagaaaccatccaacgc
accacagccagagatccaatccatcctcctgatccacctattaaactaaagattggcctt
gtaaccaagaacacggtgagcttgacatggaaaccaccgaagaatgatggtggagctcct
gttacacattataatgttgaatgtctccgctgggatcgtactggagaagtgaaagagact
tggaagcaatgcaacagacgtgacgtggaggaaacaaagtttactgttgaggatcttgta
gaaggtggagaatatgaattcagggtcaaagctgtaaatatagcaggtcctagtaggcct
tcagccactgttggcccacttgttgtcaaagaccagacatgtccaccatctattgaactc
aaagaatttatggaggttgaagaaggaacagatgttaacattgtggccaagataaagggt
gtacccttccccacattaacgtggctaaaagcttctccaaagaaaccagatgacaaaaca
ccagtgctgtatgatcaacatgtcaacaagatcattggtgaagatacttgcactttattg
attcagcagtctcgcagaagtgatacaggcttatatactataacagctgtaaataatctg
ggaactgcttcaaaggagatgagactaaatgttctgggtcgtccaggacctccagtggga
cctattaaatttgaatccattttggctgataaaatgacaatatcatggcttcctccatta
gatgatggtggttctaagattacaaactatgttatagagaaaaaagaagcaaatcggagg
acatgggtacctgttactaatgagcctaaggagtgcttattcactgttcccaaactgatg
gaaggccatgagtatgtgttccgcattatggcacaaaataaatttggtattggagaacct
ttggatagtgaaccagaaacagcacgaaaccttttcactgttcctggaccgtgtgacaag
ccaacagttagcagtataacacgtgactcaatgactgtaaactgggaagaaccggaacat
gatggtggctctcctattactggttactggttggagcgcaaagagactactggaaagaga
tggaccagggttaaccgtgatcctattaaacctatgacactgggggtttcatacaaagtt
acaggtcttattgaaggctctgaatatcagttccgtgtttcagctatcaatgcagctggt
gttggtccaccaagcatgccatctgacccagcaattgctagagatcctattgccccacct
ggccctcctattccaaaagttactgattggacaaagtcttctgtagacttggagtggaca
ccaccactaaaggatggtggttctagggtcactggctacattgttgagtataaagaggaa
ggaaaggaagaatgggaacgggtaaaagataaagaaattagaggaaccaagttcgtcgtg
gcaggattaaaagaaggatgtttttataaatttagagttagagcagtgaatgctgctggc
attggagagcctggagaagttacagacattattgaaatgaaggacagaattgtggctcct
gatattaatttggatgcaagcgtcagagacagaattgtggttcatgctggaggagtaatt
cggatcatagcatatgtctcaggaaaaccagctcccacagtgacttggagcagagatgac
cgagctttaccagaagaagccaaaattgaagaaacagctattagttcttctttggtcatc
aagaattgcaagaggagccatcagggtatatacactcttcttgctaaaaatgccggtggt
gagcggaagaagaatattattgttgatgtgctagatgtgccaggcccggttggtatgcca
ttccttactgagaacctaaccagtgactcttgtaaattgacatggtttactccggaagat
gatggtggttcacctattaccaactatataattgaaaagcgtgaatctgaccacagagct
tggactccagtaagctgcacagttacaagacagaatgcgactgttcagggactcactgaa
gggaaagcctacttcttccgaattgcagctgagaatataattggcatgggtccgttcaca
gagacaacaaaagagcttgttattagagacccaataactgttcctgaccgtccagaagac
ctggaagtaaaagcagttacaaagaactctgttacattaacttggaaccctccaaaatat
aatggaggctcagatatcaccatgtacgtactagagagccgtctaattggaaaagagaaa
ttccacaaagttacaaaggagaagatgcttgataggagatacactgtagaaggcctgaaa
gaaggtgacacctatgagtatcgtgtgagcgcttgcaatattgtggggcaaggcaagcca
tcattttgcacaaaaccaatcacatgcaaagatgaaattgctcctccatcacttgacctt
gactttagagacaaacttattgttagggttggtgaagctttcagcctgactggacgttac
tcaggcaagcctgcaccaaaggttacttggctaaaggatgatattgttgtgaaagaagat
gaccgtacaaagatcaagacaactcctacaactctttgcttggggatactaaaatctgtc
cgtggagactcaggcaaatattgtgttactgtggagaacagcacaggatcaagaaaagga
ttttgtcaagttaatgttgttgatcgcccatcacctccagtaggcccagttatatttgat
gaagttcataaagatcatatggtagtttcctggaaacctccattagacgatggaggcagt
gaaattacaaattatattattgagaagaaggatgcacacagagacctgtggatgccagtt
acatctgccacagttaagacaacatgcaaaatacctaaactgcttgaaggaagagaatat
caaattcgaatttatgctgaaaatctttatggcataagtgatcctctcatctctgatgag
atgaaagccatggaccgtttccgtgttcctgatgcacctgagcaaccaatcattaaggat
gttaccaaaaactctgcagtagtggtttggaacaaaccatatgatggaggcaagccaata
acaaattatattgtagaaaagaaagaaacaatggctacaagatgggtcaaagttaccaag
gacccgattttcccaagtactcagttcaaagtacctgacctccttgaaggctgtcaatat
gaattccgtgtttcagcagaaaatgaaattggtgttggtgatcctagtccaccatcaaag
ccaatttttgccagagacccaattgcaaaaccaagtccacctgttaatccagaagcagta
gataaaactaaaaattcagttgatttatcttggcaaccaccacgccatgatggtaatggc
aagataattggctatcttgttgagtatcagaaagttggagatgaagaatggaaaaaggcc
aatcttacagcagattcttgtcctgaaacaaaatacaaagtcactggcctgactgagggt
ttgacctataagttcagggtcaaggcagtgaatgcagcaggtgaatctgaaccagcctat
gttcctgatccagtggaagtaaaggacagacttgaacctcctgagctgatacttgatgct
aatatggcccgagaacagcatgtaaaggctggagataccctgagacttagtgctgttatt
aaaggtgttccattcccaaaagtctcttggaagaaagaagatcatgaggtttcacccaaa
gctgatattgaggttacaggagttggcagtaagcttgaaattcgtaacactgtccatgaa
gatggtggaatttactctctgaccgttgaaaatccagctggttcaaagactgtttcagta
aaagttgtggtcttagataagcccggtccacccagaaatctgcaagtcagtgaagttaga
agcgattcttgctatctcacttggatggaaccagaagatgatggtggctctgtcattacc
aactacgtggtggaaaggagagatgtagcttctgcgcagtgggtagccatctcatcaacc
tccaagaaacgcagtcacatggctaaatatctgattgaaggcactcagtatctcttccga
gttgcagctgagaatcagtttggtagaggtccatatgtggaaacactcaagcctattaaa
gctgtagatccactgcatcctccagggccaccaaagaatctgcatcatgtagatgttgac
aagactgaagtttcccttgtttggaatcgaccagatcgtgatggtggtgctgagataact
ggatatttggtggaatatcaagaagatggtgcagatgagtggacaaagttccagactgtc
cctatgctagactgtgttgttacaggcctacaaaaaggaaaaatatacaaattccgtgtg
aaagctcagaatatcgttggtcttagccttccagatacaactatacccatagagtgccaa
gaaaaactagtacctccatccgtggaactagatgtgaagttaattgaaggtcttgttgtt
aaagctggcaccacagtaagacttcctgcgattatgagaggtgtgccagttcccactgca
aaatgggctactgatggcattgaaataaaatcagatggcagacacaagattgatactgac
aatttttcaactgtacttaccatcaaagactgtgtaagaaaagatacaggagaatatcta
ctcacagtatctaatgcagctggcagcaaaactgttgctctacatcttacagttttggat
gttcctggcccaccaactggtcctattaatattcttgaagtaacaccagaacatatggtt
atttcttggcgtcctcctaaagatgatggtgggagtccaataataaattatattgttgag
aagcgtcaatcaaagaaagaaacttggggggtggttagctctggaacaagtcacacaaaa
attaagattccacgactgcagaaaggctatgaatatattttccgcgttcgggcagaaaat
aaaataggcattggtgcaccccttgattcagaaccaacaattgcaaaacatatgtttgat
ccaccatccccacctggtaaaccaactgtttatgatattacagaaaatgctgcaacagtg
tcttggactctgccaaaatctgatggtggaactccaataactggttatatacttgaacgt
cgggaagcatctggtaaatgggtgcgtgtcaataagacaccaatacttgatatgaaatac
agagtcactggtctttttgaaggcaacacatatgaattcagagtttttgcagaaaacatg
gtgggcttaagcaaaccatctccaagctctgatccaataaaagcatcacgtcctatcact
cctcctggaccaccgataaatccaaaattaaaagacaaaaccaaagaaacagctgatctt
gtgtggacaaagcccctcaaagatggtggcagcccaattctgggatatattgtggaatgt
cagaaaactggaactacgcagtggaataggattaataaggatgaactcattagacagtgt
gctttcagagtgcctgggttaatagaaggaaatgaatataaattccgtataaaagctgtc
aacattgtgggagagggagaaccaagagaactggcagaaactgtacttgcaaaggatatt
ctttctcctccagaagtaagcctagatgtgacctgtcgagacttaattactgtccgagta
ggccaaacaatccgtattactggtaaagtaaaaggcaggccagatcctgacattacatgg
tctaaagatggcaaagtactagtccaagaaaagcgtgttgaaatagtccatgatctacct
aatattgaacttcaagtgaaagaagccaaaagatctgatcatggcaaatatataatagca
gcgaagaacagctgtggacatgctcaagcttttgctgttgttaatgtacttgacagacct
ggaccatgtcagaacctgaaaataagttatgtcaccaaagattcttgtatgatcgcttgg
gagagtccagtggataatggtggctctgaaattacaaattacatagttgagtaccgtcaa
ccaaaccagagaggatggtcaattgtctcttctgatatcactaaacgattagtaaaggca
aaccttatagagaaccgtgagtacttcttcagagtttgtgcagaaaacaaaataggtcca
ggtccttgcattgagaccaagacgcccatccttgccattaatcctattgacaagcctgga
gagccagaaaatcttcacattgcagagaaaggaaagacatttgtgtatctgaaatggaga
aggccagattatgatggtggaagtcccaatttaagttatcatgttgagagaaaattgaaa
gattcagatgaatgggaaagggttcacaaaggcagcattaaagaaacacactacatggta
gataaatgtgttgaaaataagatttaccaattccgagttcaaaccaagaatgaggcaggt
gaaagtgactgggtaagaacagctgaagttgttgtgaaggaagatctgcagaaaccagtg
ctagacttgaagttaagtggggtgctgactgtgaaggcaggtgacacaattagaattgag
gctggagtcagaggaaaaccacagcctgaagttgtatggacaaaagacaaagatgccaca
gatctaaccagatctccaagagtcagtattgaaacaacttctgacacatctaagtttgtt
ctcacaaaatcaaggcgcagtgatggtggcaaatatgtgatcactgcaactaacacagct
ggcagttttgtagcatatgctactgttattgtcttggataaaccaggccctgtaagaaac
ttaaaagtcactgacatttcaagtgatagatgtactgttacttgggagcctccagaagat
gatggtggttgtgaaatacagaactacatcctggaaaaatgtgaaagcaagcgtatggtt
tggtctacatactcttcctctgtcctaacaaactatgcaaatgtgacacgcctcattgaa
ggtaatgaatatatattcagagttcgtgcagagaataaaatgggcaccggtccaccaaca
gaaacacacccaattattgcaaaaacaaaatacgatagacctggacgccctgaccctcca
gacgtcacaagggttagcaaagaagagatgactgtagtttggaatccgccagaatacgat
ggtggcaaatcaattacaggatacattttagagaagaaagagaaacgatcactaagatgg
gttcctgttactaagactccaatcccagagagacgcaagaaggttactaatctcatccct
ggtcatgaatatcagttccgcgtcagtgctgaaaatgaagttggacttggagaaccaagc
ttgccatcaagacctgtagtagcaaaagacccaatagaaccacctggtcctcccacaaac
ttgagagtggttgatagcacaaagagttccataactctcggctggggaaaaccagtgtat
gatggtggtgctccaattattggatatgttgtggaaattagaccaaaagttgagggtgct
gatcctgaagcaggatggaaacgatgcaatgttgctgcccaacttattcatacagaattt
acagccaccagcctggatgagaaccagttatatgagttcagagtttctgcccaaaaccag
gttggccttggccgaccagctgaactgaaagaagctgtgtctcccaaagaaatacttgaa
cctcctgagattgagttggatgcaagcatgcgaaagttagtcacagtcagggcaggctgt
cctattagactttttgccattgttaggggtcgtccagcaccaaaagtcacctggaggaga
atgggtattgataatgttatcaggaaaggacaagttgatctagttgacactatggccttc
tgtgtcattcccaattcaacacgtgatgactcaggcaaatattcattaacacttgttaat
gcagccggagaaaaggctgtgtttgtgaacgtcagagtcctggatactcctggacctgtg
gtggacttcaaggcttcagatgtcaccaagatgtcatgccatctttcatgggcacctcca
gagaatgatggtggtagcccagtgactcattacatcctgcagaaacgtgaggctgacagg
aagacttggggaacagtcactgcagaactaaagaaaactagtttccagatagctaacctt
gtacctggaaatgaatatttctttagagtaatagcagtaaatgaatatgggtctggtgtt
ccgagtgacataccaaaaccggttctagcaacagatcctctaagtgaacctgatccaccg
aggaaacttgaagttactgaaattacaaagaatagtgctaccttaggctggctgccacca
ctgcgtgatggaggctctaaagttgatggctacattgttagctacagagaagatgaccaa
ccagcggatcgctggacagaatattcagttgttaaagatctctccattgtagtagctggt
ctgaaagagggaaagaagtacaagtttagagtggcagctagaaatgccgtaggagtaagt
ttgccaagagaaactgaaggagtatttgaaattaaagaacaactcatcccgcctaagatt
ctgatgcctgatcacgttcacattaaagctggaaagaaactgagaattgaagctcatgta
tatgggaagcctcagccagtctgtaaatggttgaaaggagatcaagatgtacttacatcc
agtcgtcttgctgtgcataaagcagaaaagtcttctgttcttatcattaaggatgtgact
agaaaagattctgatttttacactcttactgcagaaaatagctctggtactgatagtcag
aaaatcagagtgatagtcatggataaaccaggtccaccacagcctccatttgatatttct
gaaatagatgctgatgcttgcagtcttgcatggcatatacctcttgaagatggtggcagt
aacattacaaactatgtagtagagaaatgtgatgtaagtcgaggagactgggtcacagct
ttagcttctgtcacaaagacaagctgcagaattggaaaactgattcctggagaagagtat
atgttccgtgttcgtgctgaaaatcgttttgggatttctgagccacttacttctggcaag
atgattccaagattcccatttgatgttcctagcgaaccaaagaatgcacgtattaccaag
gtcaataaggactgcatttttgttgcctgggatagaccagatagtgatggaggcagtcca
atcactggttatctcattgagcgcaaagaaaggaacagtttattgtgggtgaaagctaat
gacacagctgtgcgctccacagaatacccttgtgtggggctcatcgaaggtcttgagtat
actttcagaatttatgcactgaacagagctggagcaagtaaacctagtaaaccaactgag
tttgtcacagcaagagcaccagttgatccccctgggaaacctgaagttattgatgtcact
aagagtaccgtatcactggtatggacaagaccaaagcatgatggtggtagcaaacttatt
ggctactttgttgaagcttgcaaattacctggtgataagtgggttcggtgcaacacaact
ccacaccaaatacctctagaagagtacactgctactgatttggaagaaaatgctcagtac
cagtttagagcaattgccaagacagcagtcaacattagccgaccttcagaaccttccgat
ccagtgaccattcatccagaaaatgttccgcccagaatagagttggatctgtctatgcaa
tcacagcttacagtaaaagctggaactaatgtgcgtttggaggcaaatgtatatggcaag
ccaatgcccacaatcaaatggaagaaagaaggagaagttttaaagccttctgaaggtgtt
aagataaccactaagagaaatcttgctacagttgaattgttcagtgttaacaggaagcaa
acaggagactacactattactgctgaaaatgcaagtggatcaaagtcagcaaccattaag
cttaaagtacttgataagcctggtccaccggcctccgttaaaatcaaaaatatatatgca
gatcgtgcaatgctttcttgggagcctcctctggaagacggaggctcagaaattactaac
tacattgtagacaagcgtgaaacgagcagaccaaactgggcccaagtcagtgccaatgta
cccattacaagctgcacagtggagaaactaatagaaggacatgagtatcagttccgcata
tgtgctgaaaacaaatatggagttggagatcctatcttcactgaaccagcagttgctaag
aatccatatgatgtacctggaccttgtgatccaccaataattagcaacgtaacgaaagac
tttatgactgttagctggaagccaccagctagtgacggtggatccccaataactggttac
atacttgagaagcgtgaaactaaggctcttaactggacaaaagtaaacagaaagcctgtc
attgaaagaactgttaaggctactggactccaagaaggaacagaatatgagttccgggtg
atagcgttgaataaggctggacctggcaagcctagcgcaccatctaaagcagtgtatgct
cgtgatcctcaatatcctcctggcccacctgctttcccgaaagtggttgatacgactcgt
aattcgataagcctgtcatggagcaaaccagcatatgatggaggaagccctattattggt
tatctagtggaagcaaaaagggctgacacagacaactgggtcagatgcaacctacccaag
aacttacaggctacacgatttgtagtaacagggctgatggaagatacagagtaccagttc
cgcatttatgctgtcaataagattggatacagtgatccaagtgatgttcctgataaacac
actgccaaagacattttaattcctcctgaaggagaacttgatgcagaactaagaaaagtc
cttgtgttgcgtgctggagtcacaatgagactttatgtgccagtaagaggacgtccacct
ccaaagattacatggtctaaagtgggtgccaacctaagagatagacaaggattagacatc
aagtcaactgattttgataccttcctgcgttgtgaaaatgtaaacaaatatgatgctgga
aaatatgtcctcagtctggagaacagctgtggcaaaaaggcatacaccattgttgtaaaa
gtacttgataccccaggccctccaattaacctgattgtaaaggaagcatctaaggattcc
gccttcattacatgggaacctccgctaatagatggtggcagtccaatcacaaattatgtc
gttgaaaaacgtgatgcagaaagaaagtcatggtccacagtaacaacagaatgtccaaag
acaagcttcagggtaactaacttagaagaaggcaaatcttacttcttcagggtttttgct
gaaaatgaatatggtattggtgacccctgtgaaactcgtgatgctgttaaagcttctgaa
acacctgggccagttgtggatttaaaagcttcagctgtaacaaaatcatcatgcaattta
gtgtggaaaaaacctatcagtgatggtggaagccgtatttttgcatatgttgtcgaggtc
ctgattggtgaagataattggcaagaagtcatgcgggcaaagaacctccatttttcgatg
agagacctaaaagaaggacaagaatatactttcagagtgagagcccagaatgatgctgga
tatggaactccaacagagctcacaattgtggcaagagatgatgttgtggcacctgatctt
gatttaagagatctacctgatttgtgctatatagctaaagagggtagcaatttccgtctt
aaaatcccaattaaaggcaagcctgtcccaactgtaacttggaagaaagatgaagaccag
gcacttgctgagagtggaagagttgcatttgattctacagcagttaacaccacacttgta
gtacatgactgccagaaagctgatgctggaaagtacacaataactctgaagaatgttgct
ggcagcaaggaaggcactatttctgtgaaagttgttggcaaacctggcataccaacaggt
cccgtgaaatttgaagaagtcacagctgatgctataaccttaaagtggggccctccaaaa
gatgatggtggttcagaaatcactaactatgtcctagagaagagagataatgtcaacaat
aagtgggtgacttgtgcctctgcagtccagaaaaccatgtttagagttacaaggcttcat
gaaggaaatgaatatacattcaggatcagggctgaaaataaatatggagtaggtgaaggt
cttaaatctgaccctgtcattgcaaaacatccatttgatgtgccagatgctcctccacct
cccaacattgttgatgttcggcatgaatctgtagctttaacttggactgatcccaaaaga
actggaggctcaccaatcacaggttatcacattgaagtcaaagaaagaaatagtcttctg
tggaagagagcaaataaaacaccaataagaatgaaagatttcagagtgacagggttaact
gaaggtctggaatatgaattcagagtaatggcaatcaatatggctggagtaggtaaacca
agtctgccatctgaaccggttgtggcacttgatcctattgatccccctgggaaacccgaa
gttatcaatgtaactaggaactcagtaacactcatttggacagaaccaaaatatgatggt
ggacataagttgattggctatattgttgaaaagcgtgatttaccctcaaagacttggaca
aaagctaatcatgtgaatgttccagactgtgcatttactgtaactgacctcactgaaggc
tccaaatatgagttcagaattagagcaaagaacactgctggagctatcagtcctccatct
gaatccacaggaaccataatatgcaaggatgagtatgaggcaccaagcattgttatcgat
cctactttgaaggaaggtttaacagttaaagcaggagacaccattacagtatctgctatt
agtatccgtggcaaaccacctccaacttcagcatggtcaaaagctggaaaagattttaga
ccttcagagcttgtgcacattgaaacgacaccaacttcttctactctaaccgttaaatac
gcagccagaaaagattctggagaatacacaatcactgcaaccaatccttttggcactaag
caggagagcatacatgtaaaagttttagatgttccaggacctccagggcctattgagatc
agcaacgtttcagcagaaaaagcgactcttacgtggtcgcctcctgcagaagatggtgga
tcaccagtcaaatcatatgttcttgaaaagagagaaactagccgactgctctggacattg
attgctgaaaatattgaaagctgtaggcatgttgttagcaagctcattcaaggaaatgaa
tatattttccgtgtctcagcagtaaatcagtatggcaagggtgaaccagtacaatcagaa
ccagttaaaatggtggatagatttggtcccccaggtcctcctggaaaaccagaagtaacg
aatgtgactaaaaatactgtcacagttacctggaaaaggccagtagatgatggtggaagt
gaaatcacaggttactatgtggagcgaagagaaaagaaaggcttaagatgggtcagagca
acaaagaaaccagtttcagatcttagatgcaaagtaactggtctcctggaaggaaatgaa
tatgaatttcgtgtcagtgcagaaaatagagcaggagttggaccaccaagtgatgcttca
aactcagttgtatgcaaggatgttgcatacccaccaggtccacctgcaaatccaagagtg
actgatactacaaagacaagtgcatctttagcctggggcaagcctcactatgatggtgga
cttgacatcattggctatatagtagagcatcaaaaggaaggagaagaagaatgggtaaaa
gacacaacagggactgctttaagaatcactcagtttgttgttgctcatctgcagacagga
gccaaatacaatttcagaatctctgccatgaatgctgcaggtgttggtgaaccagcaatt
attcccagtgtggaaataaaagaccgggaagagattcctgactttgaattagatgctgag
ctaagaagaacgcttgttgttagagctggattaactattcggatttttgtgcccattaaa
ggaaggccaactccagaagttacttggacaaaagatggtgtttcactcaaaggacgtgcc
agtattgaaaatacagactcttttacactcttgattgtcacagaatgcaccagatatgat
gcaggaaaatacctaatgactcttgaaaatgctgctggtaagaagactggctttgtaaat
gtaaaagtcttggatacaccaggtccaccaataaaccttaagcctagagaaataaccaaa
gacagcatcaccctgcagtgggatatgcctctgatagatggtggttcacgtataacaaac
tatattgttgagaaacgtgaatcgactcgaaaagcatattcaacagtcacaaccaactgc
cagaagtgttccttcaggattcctaatttggctgagggatgtgaatactatttcagagtg
ctggccgaaaatgagtacggtattggtgaaccagctgaaactgcagaaccagtaagagct
tctgaggcaccatccccacctgagagccttaatattatggatgtaacacggaattcagtt
agcctggcctggccaaaaccagaacatgatggtggcagcaaaatcactgggtatgttatt
gaagcacagagaaaaggaaccaaccagtgggcacacatcactactgtaaaaactctggac
tgtgtagtaaagaatctaactgaaaatgaagagtatactttccaggttatggcggttaac
agtgctggaagaagtgccccaagagaaagcaggccagttattatcaaggagcaaacgatg
ctaccagagtttgacctccgtggtatctaccagaaaacagtcattgccaaagctggtgac
aatatcaagattgaaatccctgtgcttggtcgtccaaggcctactgtgacttggaagaaa
gaagaccagatacttaagcaaacacaaagggtaaattatgagaataccgcaactgcaacc
atactaaccatcaatgaatgtaaaagaagtgatagcggtcaatatccactgtcagctaaa
aatattgttggagaggttagtgaagtaatcacagttcaggttcatgacatacctgggcct
cctactggaccaatcaaatttgatgaaatttcatctgactttgtaacattctcatgggag
ccccctttgaacgatggtggtgtaccaataagtaactatgttgtagaaatgcgtcagact
gacagtaccacatggactgaattggcaactacagtgatacgtactacatttaaagccatt
cgtctgactactggagttgaatatcagttccgcgttaaagctcaaaacagatacggaatt
ggtccagccattacttcagagtctgtagttgccaactacccatttaaggtacctgggcct
cctggcactcctcaggtgattgcagtcaccaaagaaaccatgaccattagttggaatgag
ccagttactgatggtggaagcccaattctgggatatcacattgaacgaaaagaacgaaat
agcattctttggcagactgtaagtaaaatgctggtatcaggcaatatctttaaatcaacc
ggacttaccgatggcattgcatatgaattccgtgttatcgcagaaaatctggctgggaaa
agtaaaccaagcaagccatctgagcctgtgttcgccctagacccaatagatccacctggt
aagccgatacctctgaacattacaagacatgcagttacactgaagtggactaaaccagaa
tataatggcggttttaagataactggctacaccgttgaaaaaagagaccttcctagtggc
cgttggctgaaggctaatttcagcaatatactagagactgaattcactgtaagtggtttg
acagaagatgctgcctatgaattccgtgtgattgctaggaatgctggtggggctgttagt
cagccctctgagccatcagatgcaataacttgtagagatgacattgaagcaccaaagata
aaggtggatgcaaaatacaaagacactttagtgctgaaagcaggtgaagttttcagactt
gaggctgatgtttcaggtcgccctccaccaactatggcatggacaaaaggagaaaaagaa
cttgaagacacagcaaaattagaaataaaaatagcagatttctctactgttcttatcaat
aaagattcttcaagaagagatggtggtgcctatacacttactgcaacgaatcctggtggc
tttgccaagcatatcttcaacgttaaagttcttgatagacctggtcccccagaagggcct
ttggctgtgtcagaagtcactgcagaaaaatgtgtactgtcatggctacctccactggat
gatggaggagcaaagattgaccattatgtggttgaaaaacgtgaaaccagtagattggca
tggacagctgtagccacagaagttccattaactaaactgaaggttactaagctgttgaag
ggtaatgagtacgtgttccgtgttatggctgttaacaaatatggagttggtgagcctctg
gaatcagagcccattcttgcagtaaatccatacgtgccacccgacccacctaaaacacct
gaagttacagcaattacaaaagattctatggttgtctgttggggccatcctgattctgat
ggtgggagcccaataactaactacattgtggaacgtcgagacaggactggtctacgatgg
gtgaaatgtaacaaacgggttgttactgacttacgttataaagtgtctggactgacagaa
ggccatgagtatgaatacagagtcatggctgaaaatgctgctggagtcagtgagccaagc
ccaaccagtccattctataaagcttgtgataccgtatttaagcctggtcccccaggtaat
cctcgtgttttggatagtagcaagtcctcaattacaatagcatggaacaaacccatatat
gatggtggttcagagattacaggttacatggttgagattgcactacctgaagaagatgag
tggaagattgtaactccaccaataggtctaaaggccacttcttttaccatcactgacctg
aaagaaaatcaagagtataaaatacgaatatatgctatgaactctgaaggtcttggagaa
cctgctcttgttcctgggactccaaaagctgaagaaagaatgctacctccagagattgaa
cttgatgcagaactacgtaaggttgtcactattagagcctgctgtactctaagactcttt
gttccaattaaaggaagaccagcacctgaagttaaatggacaagagaacatggggaatct
ttggatagagcaagcattgaatcaacaagttcatatactctacttattgttgaaaatgta
aatagatttgatagtggcaaatacatactgacaattgaaaacagctcaggtagtaaatca
gcatttgtgaatgtcagagttcttgataccccaggggcgcctcaagatttgaaaataaaa
gaagttacaaaatcatcagttacactcacatgggagcctcctctcatagatggtggctct
aaaataaaaaattacattgttgaaaaacgtgaatcgacgagaaaagcttattcaactgtt
aatgccaattgccacaagaccagctggaaagttgattcactgcaagaaggctgcaactat
tacttcagagtcctagctgaaaatgagtatggaataggccttccagttgaaacatcagaa
tccgtaaaagtatcagaaagaccacttccaccagggaaaataactttgttggatgtgaca
agaaatagcgtatccttatcttgggaaaaacctgaacatgatggtggtagcagaattctg
ggctacattgtcgaaatgcaaagcaaaggcagtgaaaagtggtctacctgtgctacagta
aaagttactgaagccactattacaggattgatccaaggtgaagaatacaccttccgcgtt
tcagctcagaatgagaaaggtatcagtgatcctcgccagctgggtataccagttgttgca
aaagatcttgtgattccaccagctttcaaactactgtttaccactttcagtgttctagcc
ggagaggacttaaaggttgatgttccttttgttggtcgacccaaaccagcagtgttttgg
cataaagataatgtggcactgaagcagactacaagagtaaatgcagaaagttcagaaaat
aacacagtgttaacaataaaagaagcatgcagagaagatgtggggtcatatttagttaaa
cttacaaactctgcaggtgaagcaactgagaccctaaatattgttgtccttgacaaacca
ggacctccaactggaccagtaaaagtagatgaagtaacagcagatagcattaccatttcc
tgggaaccacccaaatatgatggtggtagctctatcaataattacattgtagaaaaaaga
gacacttccaccaccacttggcatattgtgtcagctactgttgcaagaacaactataaaa
gcatgtcgattaaaaactggctgtgaatatcagttcagaatcgcagctgagaacaggtat
gggaaaagtacctatctcacttcagagccaatcatagctcaatacccgtttaaagttcct
ggtccacctggaacaccttttgtaacaaatgtctcaaaagacagcatggtggtacaatgg
aatgaaccagtcaatgatggtggtagcaagatcattgggtatcacttggagcgtaaagaa
agaaacagcattctctgggctaaactgaataaaacacctattccagatactaaatttaag
acaactggccttgaggaaggtcttgaatatgagttcagagtttatgcagaaaacatagtg
ggcattggaaaggcaagtagagcatctgaatgctatactgcacatgacccatgtgaccct
ccaggtcgtccagaacctataattgtcacaagaagctcagtaacacttcagtggaagaaa
cctgtatatgatggtggaagtaagatcacaggctacgttgttgaaaagaaggagctgcct
gatggtcgctggatgaaagcaagctttacaaatgtcattgatactcagtttgaagtaact
ggtctagttgaaaaccagaggtatgagttccgtgttatagcacgaaatgctgcaggtgtt
ttcagtgaaccatctgagagctcaggggcaattacagcaagagatgaagtagaaccacct
cacataagtatggatccaaaatacaaagacactattgtagtgaatgctggtgagtcattc
aagcttgacgctgatgtccatggtaaaccaataccttccattcagtggttaaaaggcgat
agcgagctgacaaacactgctcgtatggaaataaaaactaccgattttgcaacaagtctc
agtgtgaaggaagccattagaattgacagtggtcagtatgtactactggcaaaaaatgtt
gcaggtgaaaagaaagttcctgttaatgtcaaagttcttgatagacctggaccaccggaa
ggacctgttgagattacaggcgttactgctgaaaaatgcatgctatcatggaaacctcca
ctccaagatggtggtagtgatatttcacactatgttgtagaaaaaagggagaccagtcgt
ttggtgtggacagtcgttgattcaaatgtgcaaaccctaaattgcaaagttacaaaactt
ttagaaggaaatgaatatgttttccgcatcatggcagtgaacaaatacggcattggtgaa
cctctcgagtctgaaccagtacttgccaagaacccatttgtagtgccacttccaccaaag
gcaccagaagtcacagccattaccaaggattctatgatagttgtatgggaaaggccagcc
tcagatggtggtagtgaaatcttgggctatgttcttgaaaaacgagataaggaaggcatt
cgttggacaagatgcaacaaacgcctgataagtgaactgcgatacagagtgactgggctt
atagaaaatcacgattatgagtatagagtttcagctgaaaatgctgctggtcttagtgaa
ccaagcccaccttccacttactacaaagcatgtgatcctatttacaagccaggtccaccc
aataatcctaaagttgtggatgttacaagatcttcagttttcctttcatggagtaaacct
atctatgatggtggctctgaaattcagggatacattgtggaaaaatgtgatgtaagtgat
ggtgaatggtcaatttgtacccctccaaccggaattaagaatactcacatggaagtagaa
aagttagtggaaaaacatgaatacaaattccgcatatgtgcagttaataaagcaggagtt
ggagagcatgcagatgttcttgattctgttatcgtggaagaaaagatggaagcaccagac
cttgaccttgacatggaattaaggaagattgtaaatgtgagagcaggaggttccttaaga
ctgtttgttcccatcagaggtcgtccaacacctgaagtaaaatggggtaaaatggatggt
gagatcagagaggcagctattattgataccactagcagttttacttcccttgtcctagac
aatgtaaacagatttgataccggaaagtatactctgactttagaaaacagcagtggaaca
aagtctgcctttgtcactgtaagagtactggataccccaagtgcacctgttaatttaaaa
atcagagagatcactaaagactctgtttcactttcatgggagcctcctctcttggacggt
ggagcaaaaattaaaaattacattattgaaaagcgtgaagcaacaagaaagtcatatgca
gctgttgtaacaaactgccacaagacttcatggaaagtagatcaacttcaggagggctgc
tattacttcttcagaatctctgctgagaatgaatatggaatcggcctccctgaggaaacc
agtgacccaattaaagttgctgaagttccacagccaccagggaaaataacagtggatgat
gtcacaagaaacagtgtctcactaagctgggaaaaacctgaacatgatggtggcagcaaa
atcatacaatacattgttgaaatgcaagcaaagggtagtgagaagtggtcagaatgtgct
cgtgttaaaacacttgaagcagttattactaacctaacccaaggggaagaatatcttttt
agagtaatggctgtaaatgaaaagggtaaaagtgatcctagagcacttgcagttccaatc
attgccaaagacctggtgattgaacctgatgtaagacctgcttttcacagttacagtatc
caagtgggacaagatctgaaagtagaagtaccaattgcaggtcgacctaaaccaaccgtt
acctgggtaaaggatggccagccattaaggcagacaacaagagtcaatgtgagcgatttg
actgatctcactatattgaatattaaagaaactagcaaagaggacggtggcacttatgaa
atcactgttgctaacgttgttgggcaaaagtctgcctctgttgaaattataacgctagac
aaacctgacccaccagtaggaccggtgaaatttgatgaaataagtgcagaaagtattacc
ctatcatggaatcccccagcgtacacaggcggctgccaaatcaccaactatgttgttcac
aagagagatacaaccaccactgtatgggaaacagtttcagctactgttgcaagaactacg
ctgaaggtgactaaactgaaaactggttcagaataccagttcagaatatttgctgagaac
aggtatgggcagagctttgcactggaatctgcacctgttgtagcacagtacccctacaaa
gaaccaggacctcctggcacaccatttgtgacaacggttacaaaagactccatggtcgta
cagtggcatgaaccaataaatgatggtggcagtagagtgttgggctaccatcttgagaga
aaggagaaaaacagcattttatgggctaaagtgaataaaagtattatccaggacacaagt
tttaagacaactaaccttgaagaaggaattgaatatgagtttcgagtttctgcagaaaat
attgttggtgtagggaaaacaagtaaagtttcagagtgctatgtggctcgtgacccttgt
gatcctccaggtcgcccagaagctataataataaaaaggagctctattactctacagtgg
accaaaccagaatatgatggtggaagtaagattactggctatattgtagagaaacgtgac
ttaccagatggtcgctggatgaaagctagcttcacaaatatcattgaaactcagttcact
gtaacagggcttactgaagaccaaagatatgagtttagagtaattgcaaagaatgctgca
ggtgcaataagcaaaccttctgacagtacaggaccaataacagcaagggatgaagttgaa
cttccacgaatttcaatggatccaaagtacaaagacacaattgttgtcagtgctggtgaa
acattcagacttgaggctgatgttcatggaaagccactaccaaccattaagtggtacaaa
ggagataaagagcttgaggaaactgctagatatgaaataaagaacacagatttcagtgca
ttaataattgtaaaagatgctgttagggttgatggtggacagtacattttagaagcctct
aatgttgcaggaacaaagacagtaccagtaaatgtaaaagttctggacagaccaggacct
ccagagggcccagttcaagtgacaggagttacagctgaaaaatgttcattggcatggtct
cctcctcttcatgatggtggcagtgatatttctcattacattgtagagaagagagaaact
agtcgcctagcgtggactattgttgcttcagaggttttgcctacaatgctgaaagtaaca
aaactcttggaaggaaatgaatacattttccgtattatggcagtgaacaaatatggtgtt
ggtgagccgttagaatctgtgccagtaatgatgaaaaatccatttgtggttcctggacca
ccgaaggccttggaaattaccaacatcacaaaggattctatgactgtctgctggaaccga
ccagatagtgatggaggtagtgaaatcataggttacattgtagaaaagagagaccgagca
ggcatcagatggataaaatgcaataaacgccggattacagatttgcgattaagagttaca
gggttaacagaggatcatgaatatgaattcagagtttctgctgaaaatgctgctggagtg
ggtgaatcaagtcaagtttctccttactttaaagcttgtgaccccatgttcaagcctggc
ccaccaacaaatgcacatgttgtggataccaccaaaagttcaattacacttggttggagt
aaacctatttatgatggtggttgtgaaatccagggataccttgtagaaatctgtaaagca
gatgaagatgaatggtcacttgttactccacagacaggtgtacgtgccactcggtttgaa
atcaaaaagcttaccgaacatcaagaatataaactacgagtatgtgccctcaacaagatt
ggtgtaggagaggctgcatcagttcctggtactattaaaccagaagacaaacttgaagct
ccagaacttgatattgattcagagctaaggaaaggaatagtggttagagctggggggtct
gctaggatccacataccgttcaggggacgaccaacacctgacatcacatggtctcgagaa
gaaggtgaattcacagaaaaagttcagattgataaaggcataaactacacacaactttca
attgacaactgtgatagaaatgatgctgcaaagtacatccttaaattggagaacagcagt
ggttccaaatctgcatttgttacggtaaaagtcttggacacaccaggaccaccacaaaac
ttggtggtaaaggatataaagaaggattctgctgtattatcttgggaaccacccattatt
gatggtggtgcaaaggtaaagaactatgtaatagacaagcgtgagtcaaccaggaaggca
tttgcaaatgtaagtgctaagtgtggcaagacaagttttaaagttgaaaatcttacagaa
ggagcaatttattacttcagagttatggctgaaaatgaatttggagttggtgttccagct
gaaaccacagatgctgtcaaagcctcagagccacctctgcctcctgggaaagtaacactg
actgatgtgactcagagaagtgcatcacttacatgggaaaaacctgaacatgatggaggt
agcagaattttgggatacattgttgaaatgctgcctaaaggaacagacaaatggagtgtt
gttagtgagaccaaaacatgcaatgcagttgtctctggcttgagtccaggacaggaatat
caatttcgtgtgattgcctacaatgaaaaaggcaaaagtgatcccagagcacttggaatt
cctgtgatagctaaagacttgacaattgagccaagtttcaaattgatgtttaatacatac
agtgtacaggctggagaagatctgaaggtagaagtaccatttataggtagacccaaacct
actattacttgggcaaaagatgagcagccactgaaacagacaaccaggctacatattcag
gatacatcaacatcgactatcttacatattaaagaaagcaacaaggaagacttcggtaaa
tatacagtaacagcaacaaacacagcaggtaccgcaacagagcacctgagcataattgta
ctggaaaagcctggcccaccacgaggacctgtccgctttgatgaagttagtgcagacttt
gttgttttatcatgggatccacctgattatactggtggctgtcagataagcaactatata
gtagaaaagcgtgacacaagcactaccatatggagcattgtatcagcaactgttgcaaga
acaactatcaaagcaacaaagcttaaaacaggttctgaatatcagttcaggatttctgct
gaaaacagatatgggaagagctctcctttggattcaaaaccagttgttgtgcaatacccc
tacaaggtgcctgggccacctggaaccccatttgtaacagcagcttccaaggaccatatg
attgtacaatggcatgaaccagttaatgatggaggaagcaaagttcttggctaccatctt
gagcgtaaagataagaacagcattctttggacaaaacagaacaagtcacttattgcagac
accaaatataaaacagatggccttgaagaaggtcttgaatacgagttcagagtttctgct
gaaaacattgttggcattggcaaagtcagcaaagtatcagaattatatgttgcccgagat
ccttgtgacccacctggccgcccagaggccattgttgttacaagaaataatatcacactg
aagtggaaaaaaccagaatatgatggtggaagcaaaataactggatacattgtagaaaag
aaagaactacctgatggccgctggatgaaagcaagctttacaaatgtgttggaaacagaa
tttacagtaagcggtctcgttgaagaccaacgatatgaatttagagtaattgcaagaaat
gcagcaggttgcttgagtgaaccatctgaaagtacagggccaattactgccagagatgaa
attgaagcgccaagggcttcactggatcctaaatacaaagatgtcattgtagttcatgct
ggagaaacctttgttcttgaagctgatatccacggcaaacctattcctgacattacatgg
tcaaaagatggtaaagaccttgaagaagcaactgcaagaatggaaattaaatctaccatt
cagaaaacgattcttactgtcaaagactgtataagattagatggaggtcagtatactctc
aacctcagaaatgttggtggcacaaaatctataccaatcaccgtaaaagtgcttgacagg
ccaggacctccagaaggacctttgaaggttacaggtgtcactgcagaaaaatgctacttg
gcatgggctccacctttacatgatggtggttctagtatctcacactatatcattgagaag
agagagacaagcaggctttcatggacgcaagtagcaacagacgtgcaggctctcaactac
aaagtaaccagactccttgctggcaatgagtacattttccgtgtgatggcagtgaacaaa
tatggaactggagaacccttggaatctgagccaattgtggctcggaatccttacaagtcc
cccggtcctccatcaacacctgaagtttcagcaatcacaaaagattctatggtggtaaca
tggggtcgccctgaagatgatgggggagctgaaatcgaaggttacatacttgaaaaacgt
gataaagatggtatccggtggaccaaatgcaataagaaaaggctgacggacttgcgattc
agagtaacaggtcttaccgatgggcatttctatgaatttagagtttctgctgaaaatgct
gcaggggtagggcaacccagtgagccatccattttctatcgtgcttgtgatgtgttatat
ccaccaggtccaccaagcaatccaaaggttacagacacttccaggtcatcagtttccctt
gcctggagtaagcccatttatgatggtggtgctccagttaagggatatgtagtagaagta
aaagaagctgctgctgatgaatggactacctgcacccctccaactggcctacaagcaaaa
cagttcactgtaacaaaacttaaagagaaccaggagtataacttccgcatctgtgccatc
aactcagaaggagtaggagaacctgctactatacctggtacagtcatagcagcagacaag
attgaacctcctgaaattgaacttgatgcagatctcagaaaagtagtcactgtacgtgct
agtggtacattgcgcctgtttgtcaccatcaaaggaagaccagaacctgaagttaaatgg
gagaaagcagaaggaacaattagtgagcgagctcagattgaagtcaccagttcctataca
atgctggtcattgacaatgttaatagatttgacagtggtagatacaatcttactttagag
aacaacagtggcaaaaaatcagcttttgtaaatgtcagagtgcttgatacacctagtgca
cctataaacctgacaatcagagaagtgaagaaagattttgtagcattagcctgggaacca
ccacttattgatggtggagctaaaattaccaactatgtagttgaaaagcgagaatccaca
agaaaggcatatgccacagttacaaacaattgcactaagaattccttcaaaataactcaa
ctacaagaaggatgtagttacttcttccgtgttctagctgtaaatgaatatggggttggc
ttaccagcagaaacacctgacccagttaaggtttctgaaccaccttctccacctgcaaag
gtcgttcttgttgatgtgactcgcaactctgtttcaattaaatgggaaaagccagagagc
gatggtggcagtaaaattactggttatatagtagaaatgcaaactaaaggaagtataaaa
tggagtgcatgtacacaggtgaaaacattagaagcaacaataacgggcttaagtatggga
gaagagtacagtttcagagttattgctgttaatgaaaaaggaaaaagtgatccaagagaa
cttggtatcccagtcattgcaaaagatattgaaatccagccatctgctgaactccttttc
aacacatacactgtgaaagctggagatgatcttaagattgatgtgccattcagagggcga
cctcttcccaccattagctggaagaaggatggaaatgccttaaaagagacaaccagggta
aatattcagacatcaaagacttcaacttcactgtccatcaaggaagcttcaaatgaagat
ttgggacattatgaattacatctttcaaatactgccggatcaacaacagcttctttaact
gtagttgtccttgacagaccaggaccaccaactgatgtgcatattgatgaagttagtgct
gatagcataactctgtcttggaaacctccagcatatgatggtgggtgccatattagcaat
tacattgtggagaagcgagaaactaccacaacaacatgggatgtagtatctgcagcagtt
gcaagaacatcaattaaagtatctcgactcaccactggctctgaatatcagttccgcatt
tgtgcagaaaaccgctatgggaaaagcacttacactaattctccttctgttgtggcagag
tatccatttaagcctccaggaccacctggaactcctcatgtggtgcatgcaactaaaact
ttcatggttgtaacttggcagataccagttaatgatggaggtagcagagtactaggatat
cacttggagcgtaaagaaagaagcagcattctttggacaaaagtcaacaagagccttata
cctgatacacaaatgaaagttacaggcctcgatgaaggactgctgtatgaatatcgtgtg
tatgctgaaaacattgccggcataggcaaatgcagtaaatcatgtgaaccagttgctgca
agagatccgtgtgatcctcctggtcaaccagaagttactaacattacaagaacatgtgtc
tcactgaaatggactaagccagaatatgatggtggagctaaagtaacaggatatattatt
gaacgcagagagataccagatggtcgttggctgaagtgtaattttactaatgtacaagaa
acatactttgatgtaggtggacttacagaagaccagcgatatgaattccgtgtgattgca
aagaatgccgctggactcttcagtcagccatctgaatcaactggacctgtgactgtaaaa
gatgatgtagaggctccaagaattatgatggatgccaaattcagggatgttgtagttgtg
aaagctggagaagtgtttaaagtcaatgctgatattgcaggacggccgataccagtgatt
tcatggacaaaggatggcaaggagcttgaaggaaaagctagagttgaaatagtctcgaca
gatcacactactgcaataaccattaaggactgtatccgaggtgattcaggacagtatgta
ctaacattacaaaatgttgcaggaacaagatctttggcaattaattgcaaggtacttgat
agacctggcccacctgcaggcccattagaaataaatggccttactgctgaaaaatgccat
ttatcatggggaccccctcaagaaaatggtggtgcagatattgattattatgttgtagaa
aaacgtgagaccagcagaattgcatggacactttgtgaaggagagcttagaacaacatcc
tgtaaggtgacaaaactactgaagggtaatgagtatattttcagagtaatgggagttaac
aaatatggcgttggtgagcctctagaaagtgttgctgtcaaagccctagacccatttaca
gttccaagtccacccacatctttagagatcaccaatgtgagcaaagattcaataactctg
tgctgggcaagacctgagtctgatggaggcaatgagatctctggctacgtaattgaaagg
cgtgagaaaactagcctaagatggattcgtgtaaacaaaaagccagtctatgatttaaga
gtgaaatcatctggtctccgtgaaggatgtgaatatgaattccgggtttatgcagaaaat
gcagctggccttagtcttccaagtgagaccacaccattaattagggcagaagatccaatc
ttcttgccatctcccccatctaaacctaagattatggattctacaagatcaaatatcaca
attgggtggacaaagccactgtttgatggaggtgctccagtaacaggatacacagttgaa
tacaagaaaactgatgaaactgattggacaatggctattcagaatttaagaggcacagaa
tacaccataactggattaatatcaggctctgagtacgtctttagagtgaaatccattaac
aaaattggtgtcagtgaaccaagtgatgtctcagaacctcaggtggcaaaggagagagaa
gaagaacctgcctttgatattgacagtgaaatgcgaaagactttaattgtaaaggctggt
ggatcattcacaatgactgttcctttcagaggcaaaccagtcccaaatgtaacatggaac
aaaccagacactgatcttcgtacacgagcaagcattgatacttcagataattgcacatct
cttactattgaaaaagcaacaagaaacgattctggaaaatacacattaacattgcaaaat
attctgaacactgctaccctgactttaattgtaaaagttcttgatactcctggcccacca
tctaatattacagcaaaagatgtaactaaagaatctgctgtgttatcttgggatgttcct
gaaaatgatggtggagcacctgtaaagaactatgttattgaaaaacgagaagctagtaaa
aaagcatgggtcactgtgacaaacaattgtcatcgcctgtcctacaaagtgactggcttg
caagaaggtgccatttactacttccgtgtttctggagaaaatgagtatggtgttggagtg
ccctcggagaccaaggagggaacaaaaataacagaaaaacccagcccaccagaaaaactt
ggagtaacaaatgtcacaaaggacagtgtttctctttcatggctaaaaccagaacatgat
ggtggaagcagaattgtgagctacctcattgaagctcttgaaaaaggacagcaaaaatgg
gttaagtgtgcagttgtaaagacaactcatcatgttgtccatggtcttaaggagaatgtt
gactatttcttcagggtgtttgcagaaaaccaggctggtttaagtgatcctaaggaacta
ctgctccctgttacagtcaaagaacacttagaatctcctgagattgacatgaagggcttc
cctcataacactgtatatattcgagcaggatcaaatctgaaagttgaaattcctgtttct
ggaaaaccagtgccaaaggtgacgttgtctagagatggtgttccactgaaacctactatg
agatttcacacagaaaccactgcagaaagtctcatcattaaccttaaagaaagcgtggct
gctgatgctggcagatatgatattactgctgccaactcaagtggcaccacaaaatcattt
gttaatattgttgtgctggacagaccaggtcctcctgttggtcctgttgtccttagtgat
atcactgaagagagtgtaacactcagatggcagccaccagtttatgatggtggaagtcaa
gttaccaactatattgtactgaaaagggaaacaagtactgctgcttggtctgaagtgtct
gcaactgttgctagaactgttatcaaagttatgaagctcacaacaggagaagaataccaa
ttccgcatcaaagctgagaaccgctttggcatcagcgatcacatagactcacaatgtgtg
gttgtcaagcttccttacactacccctggccctccttccacaccatgggtcatgaatgtc
acccgagagagtattactgttggatggcatgaaccagtcactaatggtggcagtgcagtc
accggataccatctggaaatgaaagacaggaatagcatattatggcagaaggctaacaag
accctcattcgcacaactcacttcaaagtcaccaccatcagtgctggccttatctatgaa
tttagagtttatgcagaaaatgcagctggcgttggaaaagcaagtcatccttctgatcca
gtccttgcaattgatgcttgtgaaccaccaagaaacgttcgtgtgtcagatatttccaag
actgccatcactctgtcgtggcagaagccagcatttgatggtggtagcaagatcactgga
tacatcgtagaaaaacgtgatcttccagatggcagatggacaaaagctagctttaccaat
gttattgagactcagttcacagtatctggtctgacacagaattcccggtatgaattccgg
gtctttgctaaaaatgccgttggttccattagtaatccctcagatgttgtgggtcctatc
acatgtgttgatacatatggtgcacctgaaattgatgtgccaccagaatatacggaagtg
gtgaaatataaagcaggaacatcagttaaactaaaactaggcatctcaggcaagccaata
cccacaattgaatggttcaaaaatggcaatgaggtgcaaaccagtgcattaatgtctatt
gaaaacacaacagaatttgcttctatacttatcaaggatgcaactcgactcaacagtggc
agctatgaattaaaattgaagaatgcgatgggttcagcatcagcccatgttagagtacag
atacttgacaagccaggacccccaagtggacctatacagtttaagacagtcactgctgaa
aagattacaataatgtgggacccgccagaagatgatggtggtgcacctgtaacacactat
gttgttgaaaagcgggagacaagtcgggttgtatggtctttaatttctgaaaaactggag
ggatgtatcataactacaacaaaagtcatcaaaggaaatgaatatgtgttccgtgtccgt
ggtgtgaacaagtttggagttggtgattcactagagtctgagcctgttatagccaaaaat
tcatttgttacacctggaccacctagtgtaccagaagccacaatgataaccaagaattct
atgactgttgtctggaataggcccactgttgatggaggcagtgaaatatcaggatatttt
cttgagaaacgtgacaagaagagtctgagttggttcaaagttactaaagaaaccattcgg
gacaccagacagaaagtaactggtctgactgaaaacagcgaatatcatttccgagtttgt
gctgtcaatgcagctggacaaggtccattctctgaagcctctgacttctacaaagctgca
gatcctgttgataagccaggctcaccaacaaagctaaaggttgtggatacaaccaagaca
tctgtcacccttggctggattaaacctgcttatgatggaggaagtccaattaccagctat
gtggtggagaagagggaaggtgaagagcaagaatggactgtagtcagtcataagggagaa
gtgagaacaactgagtatgttgtatcccgccttcagccaagtgttaattattacttccgt
gtgtctgctataaattgtgctggacaaggagagcctattgaaatgacagaacctgttcaa
gctaaagatattcttgtggcaccagagattgatctggatgttgctctccggacctctatt
gtggctaaagcaggtgaagatgtgcaaataatgattccattcaaaggaagacctcctcca
acagtcacatggagaaagggtgacaagaatcttgggactgatgaaagatatatcatccag
aacactgaatcatctacactacttactattcctcaagttacccgaaacgatacaggaaaa
tatgttcttacaattgaaaatggagttggagaagcaaaatcatcatttgtgaatgtaaaa
gtacttgacacaccgtctgcctgccagaagttgcagcttaagcatgtttctcgtggcaca
gttacactggtgtgggagccacctcttattaatggtggttctgaaataacaaattatgta
gttgaaaaaagagatgctacaaagagggcctggtcaactgtaacaacaaagtgttctcat
accacctttaagctaactaacctgtcagagaagactgcattcttcttccgtgttcttgct
gaaaatgaaattggactgggtgaaccttgtgaaacatctgaaccagtgaaagctgcagac
atacctggacctgtaaaagacctggccatgaaagattctacaaagacttctgttaaattg
cagtggagcaaacctgactatgatggtggtagcattatatcagactatgttattgaaaag
aaactgcaggaagaaaaagaatgggcatatgcaggcacaagcaagagctgtgaatttgaa
gttgaaaaacttaaagagctttctgtcatggaattcagagtctttgctaaaaatgaaaaa
ggcatgagtgatggtgttactattggacccattacagtgaaagagcatataataacacct
gaagctgacctttctgatgttcctggaggtcagattgcggtaagaattggacataacctg
cacattgaactgccctataaaggtaaacctaagccatccatgagctggcttaaggacaac
ctccctcttaaagaaactgaacatcttcgtttcaagaaaacggaaaacaagataagctta
agcatcaagaatgtgaaaaaggaacatggtggcaaatatactctaattcttgataacgta
gtctgcagaaaaactttcacaattgttgtcatcactcttggccctccatctaagccaaaa
ggacctttaagactagatgaaatcaaagcagatagtgtagttctgtcatgggaagctcct
gaagatgatgggggaggagaaattactggctacagtattgagaaaagagaaacttcacaa
ataaactggaagttggtgtgttcaagtgctgcaagaacaacattcaaagtaccaaacctt
gttaaagacactgaatatcagtttagagttcgtgcagaaaacagatacggagtgagccca
cctcttgtctcagcagatgttgtggcaaagcatcagtttagaccaccaggtgccccaggc
aaacctgttgtatacaacataactgctgatggaatgaccatatcttgggatgctcctgtt
tatgatggtggttcagagattattggataccatgttgaaaagaaggaaagaaacagtatt
ttgtggcagaaggttaatgttgccttaatatctaacagagaatacagaattactggactg
cttgagggcctggattaccagttccaagtatatgctgaaaacactgcaggtctaagccga
gctagcgagccaagcaaatttactttggcagtctctccagtggacccacctggtactcct
gattacattgatgtcaccagggaaacagtcacccttaaatggacccccccactgcgtgat
ggaggcagtaagattgtgggttacagcattgagaaacggcaaggaagcgaagaccgttgg
ctcagatgtaactttactgatgttagtgaatgccaatatacagttacaggactgagttca
ggtgaccgatatgaattcagagtgcttgcaagaaatgctgttggtacaatcagcccacct
tcacagtcttcaggctatataatgaccagagatgaaaacattgctccaacaatcgaattt
ggtcctgagcactttgaaggccttactgttaaagctggagagagcattagacttaaagct
ctaatcaaaggacgtccagtacctaaagtgacatggtttaaggatggtaaggagattgag
aaaataatgaatatggaaataactacagctattggatatagtacaatcttcattagagat
gctacccgggatcatcgtggagtgtacacagtagaagccaaaaatgcatcaggcactaaa
cgagaagacattaccttcagagtacaagacacaccaggaaaagttggcggaccgatacga
ttcacaaacattactggagaaaaagtcacattatggtgggaccctccagctaatgatggt
tgtgcttctatttcccactacataattgaaaaacgtgaaaccagcaggattgcttgggca
ttagttgaagataaatgtgaagcttgcagctacacagcacttaagttaattaagggcaac
gagtaccagttccgtgtctctgcagtgaacaaatttggagttggcagaccattggagtct
gatccagtaaccgcacaaataccttacactctccctgatgcaccaggaactccagagcct
accaatgtaacaggagacagtatcacactcacatgggcaagaccaaaatcagatggtgga
agtgagataaatgagtatattctggaaaggagagaaaagaagagcatgcgctgggttaaa
gtatccagtaagaggcccattactgagaacagatacagagtaactggccttgttgaaggc
aatgagtatgaattccatgtcatggctgaaaacgctgcaggagttggacctccaagtgat
gtttcaaagctgattaaatgcagagaaccagtcagcccaccaagtgctcctaatgttgta
aaggtgacagatacatcgaagactagtgtaagcctagagtggaccaagccagtttttgat
ggaggcatggaaataattgggtacatcattgagatgtgcaaagctgatcttgaagcatgg
cagaaagtcaatgcagagactgttcttgctactaaatataccgttgttgatttggaggca
ggagaacactataaattcagagttagtgctgtcaatggtgctggcaaaggagaaagttgt
gaagttcctgcttcagtccaaactgtagacaggctttctgcacctgaaattgatatcgat
gcaaatttcaagcagactcatattgtaagagcaggtgcaagcattcgtctatttattgcc
ttctctggaagacctgttcctactgctgtgtggtccaaagcagatgctaatcttagcttg
cgtgctgacattcaaacgactgattcattcagcacattgactgtggaggaatgcaataga
aatgattctggcaagtatgtctttactgtggaaaacaacagtggaagtaagtctattaca
tttacggtcaaggttttggacacgcctggtccaccaggtcctattacatttaaagatgtg
actcgaggatctattactttaatgtgggatgcccccgtcctggatggaggttcacgtatc
catcactacattgtggaaaaaagggaggcaagccgtcgtagctggcaagtggtgagttca
aaatgcactcgacaaatctttaaggtcactgatctggcagaaggtgtgccatactattac
cgagtgtcagcagaaaatgaatatggtgtaggtgaaccctgtgaattaacagaaccagtt
gtagccacggaagaacctgctccacctaagagactagatattgttgatacaaccaaatct
tccgtagttttagcttggcttaaacctgaccatgatggtggtagccgtgttactggatac
cttcttgaaatgaaacaaaaaggatctgactcctggattgaagctggacaaaccaaacaa
cttactttcactgttgaaggccttgtggagaacactgaatatgaattcagggtcaaggca
aagaatgatgctggctacagtcagccgagagaagctttctcttctgttattattaaggag
ccacagattgaaccaacagcagatctcagtgaaataagcagacagcttataacatgcaag
gctggaagcacctttactattgatatacctatcagtgggcgcccagctccaaaagtgaca
tggaaacttgaggagatgaggctgaaggaaactgagagagtgaccatcaagacaacaaaa
gacagaaccacactgactgtaaaggacagtatgagaggtgactctggtaaatactacctc
acgcttgaaaacactgctggtgtgaaaacatttactgtcacagtggtagtcataggaagg
ccaggtcctgtcactggcccaattgaaatatcatctgtctctgctgaatcctgtgtgttg
acctggaaagaacctgaagatgatggtggcagcgacattacgaactatattgtagagaaa
cgtgaatctggcacaacagcatggcagctggtaaattccagtgtgaaacgtacacagatc
aaagtcactcatctgacaaaataccaggagtacagtttccgagtaagctcagaaaacaga
tttggtgtcagcaaaccccttgaatcaaaaccaatagttgctgagcatccatttgtccca
ccaagcccaccttcaaggccagaagtctattctgtttctgcaactgccatggccattcgc
tgggaggaaccttatcatgatggtggcagcaaagtcattggatattgggttgaaaagaag
gagcgcaacaccatcctttgggtgaaggagaacaaagtgccatgctgtgaatgcaactac
aaaatcacaggattggtggaaggcctagaatatcagttcagaacctatgctctaaatgct
gcaggtgttagtaaagctagtgaagcttccagacctgtagtggctcaaaatccagttgat
ccaccaggaagaccagaagtaacagatgtcaccagatctacagtgtccctgagatggtca
gcacccctttatgatggagggagcaaaattatcggatatattatagagcgcaaaccatat
actgcatctggtgatggacgctggctgaaatgcaattataccattgtctcagaaaacttt
tttactgtgacagctcttagtgaagatgaagcatacgaattccgtgtactagcaaagaat
gctgctggtgtgatcagcaaaggatctgaatcaactggtgctgtcatttgcaaagatgaa
tactcaccaccaaaggctgaacttgatgccagactacagggagaagttgtgaccattagg
gctggatcagatcttgttcttgatgcagccattggtgggaaaccagaaccaaaagtcttc
tggtccaaaggtgacagggagttggatctatgcgagaaaatatctctgcaatacaccagc
aaacgagccattgcagttatcaagttctgcgacagaagtgatagtggaaaatatacttta
acagttaaaaatgccagtggaatgaaacaactttctgttcttgtcaaagtgcttgattcg
ccaggtccatgtgcaggcaaaatcacagttaccagagtaacagaagagaaatgtactctg
gcatggaacattcctgaggaagatggaggtgcacaaatcactcactatatcgtagaaaga
cgtgaaaccagcagacttcactgggttattgttgaggctgaatgccagactttatcatac
gtggtaacaaaacttattaaaaataatgagtacattttccgtgtgagagctgtcaacaaa
tatggaccaggtgttccacttgaatcagaacctgtgattgccaggaatgctttcactata
ccaacacagcctggtgcacctgaagaagtgagtgtcggcaaggaacatattattattcag
tggacgaaaccagaatcagacggtggcagtgagattaaggactaccttgtggacaaacgt
gaaaggaaaagtctgcgctggacacgagtgaacagagattacactgtttatgataccaga
ctgaaagtcactggtctcatggaaggcagccagtaccagttccgtgtcactgccgtgaat
gctgctgggaacagtgagcctagcgaagcttcacagtacatgttatgtaaagaaccatca
tatactcctgcaccgccttccactccgagagttgtggatactactaagcacagcataagt
ttagcatggtcaaagcccacatacgatggtggtgctgacatcttaggttatgttcttgaa
atgaaagaagaaggtactgaacagtggtatcgaccacatacaactgccactctgaggaat
gctgagttcactgtgactggtcttaaaacagcccagaaataccaattcagagttgctgct
acaaatgtgaatggtatgagtgaatttagtgaatcatcagcagaaatagaacctgtggaa
agaatagaaatacctgagcttgagcttgctgatgatctgaagaagacagttacagtcaga
gccggtggttccctgcgtctaatggtctctgtatctggcagacctgctcctgtaatcaca
tggagcaagcagggtgttgaccttgtgagtcgagctattattgatactacagacagctac
acccttcttattgtggataaagttaatcgctatgatgctggaaaatatgtcattgaggct
gaaaatcaatcaggaaaaaaatctgcaactatttctgtcaaagtgtatgatacacctggt
ccacctgctgcagtgagaattaaggaagtgtcaaaagattctgtgacgcttacttgggat
attccaaccattgatggaggagccccagtcaacaattatataattgagaaacgtgaagct
tccatgagagcttacaagactgtcactatcaaatgcagcaagacattttatagagttact
ggacttctagaaggagctttgtattatttcagagttctaccagaaaatatttacggcatt
ggtgaagcttgtgaaacatctgatgcagtactagtatctgatgtccccatggtaccacaa
aaacttgaagtgattgacaccactaaatcaactgttaccctggcatgggagaaaccatca
catgatggtggcagcagattaactggctatgttattgaggccagcaaagctggaacagaa
agatggctgaaggtagtgacactgaagcctaatgtctacgagcatacaattatctctctc
aatgagggtgaacagtacttgttcagggtcagagcacagaatcagaagggcatgtcagaa
ccacgagagattgtcacagcagtgacagtacaagaccaaaaggttctaccaacaattgac
ttcgctggaatacctcagaagacaattcatgtacctgctggcaagcccattgagttagct
attccaattgaaggacgaccacccccagctgtatcgtggttctttgctggttctaaacta
aaagaatcagaacgcatcaaaatggagactgttgccaaaacggctaaattaactgtgcgt
gagaccaccatacatgacactggagagtatacgctggaactgaagaacacaactggaaca
gttactgatacactaaaggttataatccttgacaaacctggaccacctgttgggcctatc
cgaattgatgacattgattcaaattatgtaaccatctcctgggagccacctgagctagat
ggtggagctacccttagtggctatgtggttgaacaacgcgatgctcaccgtcctggatgg
ctgccagtttcagagtcagtaaccagaacaatgtttaagttcaccagacttgttgaaggt
gcagaatacgtgttccgtgtcgctgctacaaaccgctttgggattggatcttacctgcag
tctgaaattatagaatgcagaagcagaatccgtattcctggtcctcctggcactccagaa
gtgtttgatgtctctcgagatggcatgacattaacttggtaccctccagaagatgatggt
gactcacagattactggttatattgtagaacgcaaagaagttagagcagatagatggatc
cgtgtgaataaagttccagtcactatgactcgttaccgttccactgggttggttgaagga
ttagaatatgaacatcgagtcacagcaatcaacgcaagaggcactgggaaacccagccgt
ccttccaagtctgctgtcgccagagatccaattgctcctccaggtaaacctcagaatcca
agagtcactgatactacaagaacatctgtctccctggcttggagtccaccagaagatgaa
ggtggttctaaagttactggctacttaattgagatgcagaaggttgatcaatttgaatgg
accaaatgcaataccacgccaaccaagattcgtgaatacaccttaacacatctcccccag
ggtgcagagtacagattccgtgtgctggcctgtaatgctggtgggccaggagaacctgct
gaggtgccaggaacagtcaaaataacagaaatgcttgactatcctgactatgaacttgat
gaaaaataccaggaaggtctcatggtgagacaaggtggagttatcaggcttacaataccc
attaagggtaaacccatcccaatatgcaaatggacaaaagaaggacacgacatcagcaag
agggccatgattgcgacttctgacactcacacggaacttgtgatcaaagatgcagaaaga
gaagattcgggcacctatgatttggcacttgaaaacaagtgtggaaaaaaagctgtttat
attaaagtcagagtgattggcattccaaatccaccagaagggccacttgagtatgatgat
atacaggctcgctctgtcagagtaagctggagacctcctacagatgatggtggtgcagat
atcctaggttatattgttgagagacgagaggtaccgaagactgcctggtacactgttgac
tccagagtgaaagggacatccctagtggtgaaagggctcaaagaaaatgtggaatatcac
ttccgtgtttctgctgaaaaccattttggtattagcaaatctctcaaatctgaagaacca
gcagtaccaaagacaccactaaatcctccagagcctccaaacaacccacctgaagtgctc
gatgttacaaagagttctgtcaacttgtcctggtccagacctaaagatgacggtggttct
cgtgtaactggctactacattgagcgtaaagagacttctacagaaaaatgggtccggcac
aataagacgcagattaccactacaatgtacacagtcacaggacttgttccagatgctgaa
tatcaattccgtatcattgctcaaaatgacatcggtgaaagtgaagcaagtcctccttct
gaaccagttgtatgcaaggatccatttgacaaaccaagccaacctggagaaattgagatc
acttctatatttaaggatagtattacattagaatgggaacgacctgaaagtgatggtggc
aaagagatccttggctattgggttgaatatcgccagtctggagaaagcacctggaaaaaa
tgcaataaagaacgcatcaaggacaggcagtttacagtaggaggtttactagaggctaca
gaatatgaattccgtgtttttgcagaaaatcagactggcctcagcagacctcgaaggact
gccatggcagtgaaaactaaattaacatctggagaagcacctgccataaaaaaagaaatg
caggatgttacaactaaactgggtgaagcagctcagctaacatgccagattgttgggaga
cctttgcctgatattaaatggtacagatttggcaaagaactggtgcaaagccgaaaatac
aaaatgtcatctgatggacgcaatcataccctgacagtaataacagatgaacaggaagat
gaaggtctctacacttgcatggctaccaatgatgttggagaaattgaaactagtggcaag
ctattattgcaggctcctcctcaattccaccctggcttcccattgaaagagaaatactat
gctggcgcaggtggcaccctccgccttcacattgtatatattggccgaccagtaccagcg
ataacttggttccacggcaacaaacctttgagaggatcagaaacaattactattgagaac
acagagcattatactcatcttgctattaagaatgtccagcacaagactcatgctgggaag
tacaaagtgcaactcagtaacacgtttggaacagttgacactgtacttaatgtggaaata
caagataagccagaaaaaccagtagggccaattgttatagagtctatactgaagaattct
gtggtgataagctggaaaccaccagaagatgatggaggtgctatgataaccaattacatc
atagagaaacgtgaagctaaagaaggagcagaatggcaacttgtatcttcaagcatttca
ggcacaacctgtagaattgttaacctaactgaaaatgcaggctattatttccgtgttttt
gctcagaatacatatggcattagtgaagcactggaggtttcatcagttgttgttatgaag
cctctatttgaaaaaccaggacaacctggtcagccagtagcaagtgctatcacaaaggat
tcttgtgttgtctcatggaagccacctgcaagtgatggtggtgcaaagattagaacttac
tatcttgagaaacgtgagaagaaacaaaacaagtggatttctgtaacaacagatgaaatt
cgtgaaacggtgtattctgtgaaagatcttattgaaggtcttgaatatgagttccgtgta
aaatgtgaaaatcttggtggtgaaagtgagtggagtgaggtatcacaaccagtcattcca
aaatctgatgtaccgattcaagctccacatttcaaggaagaactaaggaatctgaatgtg
aaatttcaagctaatgccacatttgtctgcaaagtcacaggtcatcctaaaccaattgtc
aagtggtacagacaaggcaaagaaatcatgccagatggtgaaaagatcaagatacaggaa
ttcaagggcggataccaccagctggtgatcacaaatgtaacagatgatgacgccacagta
tatcaagttagagctaccaaccaaggaggatctgtgtctggcactgcctctttggacgtt
gaagttcctgcaaagattcacttgcccaaaaacctggaaggcatgggagctgttcatgcc
ctccgaggggaagtagtgagcatcaagattccattcagtggcaagcctcaccctgtgatc
acatggcagaagggacaagacctcatcgatactaatggacactatcaagtcattgttaca
cgatcattcacatctcttgttttcccaaatggtgttgacagaaaagatgcagggttttac
attgtttgtgccaaaaacagatttggaattgatcaaaaaacagttgaattagatgtggct
gatgtgcctgatccaccaagaggtctgaaagtaactgacatttcaagggattcagttaac
ttaacctggaatgaaccagctactgatggtggaagcagaatcataaactacattattgag
aaacgtgctacaacagcagagcgatggattcgagttgcacaagctcgtgatacacgatac
acagtggtgaacctgtttggcaagaccacctaccagttccgtgtaattgcagaaaacaag
tttggccaaagccaaccttctgaacctactgatccaattataacaaaggaagataaaacc
agagtaatgaactatgatgaagaagttgatgagaccagagaagtcaccacagttaaagca
gctcactattctacaaaagaactctatgacaaatatatgattgcagaagagcttggacgt
gggcagttcggcattgcacaccgctgtgttgaggcagtttcaaaaaagacttacctggcc
aagtttgtcaaagtaaagggtgctgaccaagttttggtaaagaaagaaatttccattcta
aacattgctaggcaccgaaatatcctgtatcttcatgagtcatttgagagcctagaagaa
ttggtcatgatctttgaattcatttctggagttgacatctttgaaagaatcagcacagct
tcatttgaacttaacgaaagagaaatagtaagttacgtacgccaggtctgtgatgcgcta
gagtttctgcatcgccacagcattggacattttgatattaaaccagacaatattatttac
ttcacaagaagaagctctgtagtaaaaattgttgaatttggtcaagccagacaattgaag
cctggggacagctttagactccagttcacttctcctgaatattatgcacctgaagtacat
catcatgatttggtcagcacagctactgacatgtggtccgttggtgctctaacatatata
cttctcagtggcattaatcctttcattgctgaaacaaaccaacaagttattgaaaatatt
ctaaatgctgaatacaactttgatgatgaagcattcaaagacataagcattgaggccatg
gacttcattgatcgcctactagtaaaggaaagaaaagctcggatgacagctgctgaagcg
cttaaccatgtgtggctaaaacagcagacagaaaagaccagcactaaagtcatcaagacc
ttgaggcacaggcgttactaccaaactctagtaaagaaggagtggaacacagttgtgtca
gtagcccgcatttcctgtggaggtgctattagaactcagaaaggcataacggtggctaaa
gttaaagttgcaccaatagacatcggtcccattgctggacagataaagcatactgttaca
gaagaaggagggcatgccaaatatgtctgtaggattgaaaactatgatcagtccacacaa
gttacatggtactttggtatgaggcaattagaaagcagtgagaaatatgaaatcaaatat
gaagaaggtgtggcaaccatgtatgtcaaagatgtttctaaatctgatgatggcacctac
agatgcaaggtagtaaatgattatggtgaagatagctcttatgcagaactttttgttaaa
ggcgtgagagaaatttctgagcactacagatgcagaaccgttaggaaagtgaaacgacga
gttgatactatgagattattagagcgtccaccagaatttactctgcctttgtacaaccgc
actgcatacattggagaaaatgtcaggttcggagtaactataacagttcacccagaacct
cgcttaacatggttcaaatcaggccagaaaatcaaacctggtgatgatgataagaagtat
acttttgaatcagacaagggtctttaccaactcatcatcaataatgtcactgaagaggat
gatgctgaatacagtattgtggcacgcaataaatatggcgaagacagctgcaaagccaag
ctgactgtgattccgcatccacctccagcagatgccacgctcaggccaatgtttaaaaga
ctgctggcaaatgctgaatgtcaagaaggccaaaatgtcagttttgagatcagggtatct
ggtgtaccaaaaccaacgctgaaatgggagaaagatggtcaacctctatcctttggtcct
aactttgatataattcatgaaggtttagattattatgctttgcatattagagaaacttta
ccagaagacagtggttattacagagttactgccacaaacagtgctggatctacaagctgt
caggcttatctaaaagttgaacgcttgaaatatgtcaagcgtgagtacaagactgaagaa
gaacgggagaagcacgtacagaggcaaattgacaagaccttacgaatggcagaaatccta
tctggggttgaagctgttccactgacacaaactgcacaagaagctctcagagaagctgct
atcttatataaaccagctgttagcactaagaatgtcaaaggtgaatatgaaattaagaaa
gaagaaaagaaggaagaaagaaggcttcgtatgccatacgaggtcccagagcctcgcaaa
catgtacgcactactcttgaggaagatcagaacattaaacactttgtgcctctgtcagac
atgaagtggtacaagaggctgcgagaccagtacgaaatgccaggaaaacttgagagaact
gttcagaaacgccagaaacgcatacgtctttccaggtgggagcaattctatgtgatgcca
ctgccacgcatttctgatcagtataagcctaagtggcgcataccaaagctaacacaagat
gatcttgaaattgtgagaccagcacgtcggcgtaccccatctccagactatgaatattac
tttagaccaaggcggcgatcgcttggtgacttgtctgatgaggaattactcctgcctatt
gatgactatttagccatgaagagaacagaagaggaaagactgcgccttgaagaagagctg
gagttaggcttttctgcttccccaccaagaagtcccccacgctttgaactgtctgccctt
cggtattctactgcaggagcacaggtcagatcagaggaagaaagaaaaagagagctgagg
tattcaagctatcacatcccaactaaagccgagaccagtgcaacctatgcagagcttcgt
cagcgccatgacagggctgcctatagaccacctaaacaaaagcaaagaataatggacgaa
agagaggatgaagaattgctccgtcctgttggcactgctcaacggctctctgaatacagg
agtgagcttgaatatatggcagaggaggaaaagagtagactcaggagaaggagggaaaga
gaaataactgaaatcacatcagaagaagaagaagaaatagaaatggtgcaacatgttcac
agggaattttcacctccctctagattactaaggagaagaagatctctttctccaacttac
attgagttgatgcgtcctgtatctgaattaattcgacctcgctcacggcctcctgaagaa
agtgagagaagatccccaacaccagagagaactcgaccacgctcacctagcccagtttct
agtgaaagatcactctctcggtttgagaggatggcaagatttgatatattttctaggtat
gagtccatgaaatctgctttgaaaactcagaaagctatggaaaggaaatatgaagttctg
actcagcagcctttcactcttgaccatgctcctcgcattaccctgagaatgcgctcacac
cgagtcccatgtggccataataccaggttcattctaaatgtccagtcaaaaccaactgct
gaagtgaagtggtaccataatggtattgagctccaggagagcagtaagatacattttact
aacaccagtggtgtattaactctggagattcttgactgccacattgatgacagtggaaca
taccgggctgtatgcacaaactacaaaggggaatgctctgattatgcaacactagatgtt
actggaggagattacactacatactcttcccaacggagagatgaagaagtaccaaggtca
attttacctgacttgacaaaaacagaggcatatgcagtctcctcatttaagaaagcatct
gctacagaatcaagttcctcattaagagaggtcaaatcggaaatgtcagcaacaagagaa
tcgcttttatcatatgaacactatgctgcttctgaagaaaaaatcactgcagctgaagaa
aaatcactggaagaaaggactgtacacaagacattcaaaagcactctaccagcaacaatc
cttacaaagccacggtcaatcacagttgctgaaggggagactgcaagattctcctgtgat
gcagatggtgaaccagcaccagtaataacatggttccgtgcaggtcaacccattgtttcc
tcaaggcgcttccaagtaacacgcacacagtacaagtccacctttgaaatttcttcagtc
cagatgtcagatgaaggaagttacactgttgtggtggaaaactctgaaggaagacaggaa
gcgcactttactttgaccattcaaagaacaaaaattcctgctaaaacaattacatcaccc
ccaacaatcaaatctcctgagcctcacgtaaagtctccagagccagttaagtctcctaaa
cgagtgaaatctcctgaacccatcagtggccccccaagagcaaagtcaccacctggagac
aaatcagtaccagcagagaaagtgcaattactaactgcttctccaccaaagataaaacag
cagctgaaagcagaaactcttggagataaggtaaagctatcctgtgcagttgaaagcaat
gttttaagtgtcagagaagtggcttggtacaaggatggcaaaaaactgaaagaagaccat
catttcaagtttcattatgcagcagatggcacctacgagctcaagatccatgagctcatg
gaatctgataaaggagaatacacctgtgaaattattggggaaggaggcatttcaaaaact
agcttccagtttactggccaagtatttaaaaatatccattcccaggtaagaggtgtatct
gaaactcataaaacagttcgaaaagaagatgaggtgcttacagtttctacccagaagaaa
tcagcagtggcaactgaagaaaaagcagcagttcaagaagtcattaaaaagtcagttgtt
actgaagatgtcaaacaattgaaagcagaaattaaagcttcttcaactaaaatgacagtg
tctgaagggcagaaattgatgctaaaagccaacattcctggtgcctgtgaagtaaaatgg
gtgctgaatggaatggagctgagaaattcagatgattacagatatggtgtttctggaagt
gatcacacactaactatcaaaaaagctagtaataaagatgaaggtatacttacctgtgag
ggtaaaactgatgaaggcattattaaatgccagtatgttctgaccttttctaaagaacgc
tccaatgaaccagcatttatcatgcagcctaagtctcaaaatgtcaatgaaggacaagat
gtattgttcacctgtgaagtttctggggatccttcacctgaaattgagtggttcaagaat
aatcaacctattgctgtttcatcacacatccgagtaacacggtctaaaaacgtatattct
cttgagattcgaaatgcagcagtgagtgacactggaaaatacacagtcaaagcaaaaaat
taccatgggcagtgctctgctacagcatctttgactgtactccctctaattgaagaacct
ccaaaagaggtagtattgaagacaagtggcgacgcaagcatgcacgaaagtttttcttct
cagtccgttcaaatggcttcttctaagcaagaggcttcattcagcagtttcagcagtagc
agcatgactgaaatgaaatttgcaagcatgtctgccaaaagcatgtcctccatgaaagaa
tcctttgtagagatgagctccagcagtattatggggaaatctagtatggctcaactggag
agttcaactagtaaaatgcttaaatcgggtctgagaggagtaccacccaaaattgaagct
ctcccatctgatatcagcatcgacgagggaaaagttctcacactatcttgtgccttttcc
ggtgaacctgctcccgaaataacatggtactgcagagggagaaaaattaccagtcaggac
cagcgaggcagattccacattgaaaccagtgaagatctaaccaccttgatcatcatggat
gtccagaagaacgacggcggactttataccctgaatttaggaaatgaatttggtactgat
tctgccactgtgaatattaatattcgatcaatttag

DBGET integrated database retrieval system