KEGG   Athene cunicularia (burrowing owl): 113482544Help
Entry
113482544         CDS       T05777                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:acun01001]
    113482544 (CDK15)
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     113482544 (CDK15)
Protein kinases [BR:acun01001]
 Serine/threonine kinases: CMGC group
  CDK family
   113482544 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7
Motif
Other DBs
NCBI-GeneID: 113482544
NCBI-ProteinID: XP_026709074
Position
7
AA seq 387 aa AA seqDB search
MEAASTAELPWLHMLRSWRCRMQRPWSYTDPFQEQDVVERFTWRQGILFGAATSYVHLEK
LCEGSCATVYKGISRINGQLVALKVIRMQAEEGVPFRAIWEASLLKRLKHANIVLLHDII
QTKETLTFVFEYMHTDLAQYMGQHPGGLHSCNAMLFMFQLLRGLAYIHQQHILHRDLKPQ
NLLISCLGELKLADFGLARTKTIPRQTYSSEVVTLWYRPPDLLLGATDYSSDLDIWSAGC
IFVEMIQGQPVFAGTSGTHEQLVKIWAVLGVPTEDTWPGLSKLPNYNPELVASRRPQRLR
VICDRLSRVPAAEDLASRMLTAFPRGRISAQDALLHGFFSPLPPQVYRVPAGQSLLTVPG
VRLQPEICDLFASYKKGQLSGGSSKFW
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagcatctacagcagagctcccatggcttcacatgctccggagttggaggtgc
cggatgcagaggccttggagttacactgatcctttccaagaacaggatgttgtggagagg
ttcacatggagacaaggcatcctgtttggagccgccacatcctatgtacatctagagaag
ctgtgtgaaggatcctgtgcaactgtgtacaaggggatcagcaggatcaacggccagttg
gtggcattgaaagtgatcaggatgcaagcagaggagggagtgccttttagagccatttgg
gaagcttctcttctcaagcgtttgaagcatgccaacattgtactgcttcatgacattatc
cagaccaaggagacactaacatttgtctttgaatacatgcacacagatctagcacagtac
atgggccagcatcctggaggacttcattcgtgcaatgctatgcttttcatgttccagctt
ttgcgtggcctggcttacatccaccaacaacacattcttcaccgtgatctgaaaccccag
aacttgctcatcagctgccttggtgagctcaaattagccgactttggccttgctcgtacc
aagaccatccccagacagacatactcctctgaagtggtgacactctggtaccgtcctcct
gatctattgcttggagctacagattattcttcagatctagatatctggagtgcaggctgt
atatttgttgaaatgatccagggccagccagtatttgcaggaacttctggtactcatgaa
cagctagtgaagatctgggcggtattgggggtcccaactgaggacacctggccaggactt
tccaagctcccgaactataacccagaactggttgcttccaggagacctcagagactccga
gtcatctgtgacaggctgagcagggtgccagcagcagaggatttggcctccaggatgctt
acagcctttcctcgaggtcggatctctgcgcaagatgcacttcttcatggcttcttcagc
cctctgcctcctcaggtctatcgggttcctgctggacaatctctgctcacagtcccagga
gtgagactgcaacctgaaatctgtgacctgtttgcttcttacaaaaaaggccaactctca
ggaggttcaagcaagttttggtag

DBGET integrated database retrieval system