KEGG   Athene cunicularia (burrowing owl): 113485095
Entry
113485095         CDS       T05777                                 

Definition
(RefSeq) deoxycytidine kinase-like isoform X1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00230  Purine metabolism
acun00240  Pyrimidine metabolism
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113485095
   00240 Pyrimidine metabolism
    113485095
Enzymes [BR:acun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     113485095
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_17 AAA_33
Other DBs
NCBI-GeneID: 113485095
NCBI-ProteinID: XP_026713787
Position
13
AA seq 198 aa
MLYDKPTRWAYTFQTYACLSRVRAQLKPVSAKLREAEHPVQFFERSVYSDRYVFASNLFE
SGNINETEWAIYQDWHTWLLNQFESDIELDGMIYLRTTPEKCMERLQTRGREEEQGIELE
YLENLHYKHETWLHERTMRVDFENLKEIPILVLDVNEDFKNDKIKQEYLIDKVSIKCFLI
CLSSVVIILKLLIYILKI
NT seq 597 nt   +upstreamnt  +downstreamnt
atgctgtatgataaacccacaagatgggcttacacatttcagacttacgcttgcttgagc
cgagtaagagcacaactaaaacctgtctcagccaagctacgtgaagcagaacatccagtg
caattttttgagagatctgtgtacagtgacagatacgtatttgcttctaacctgttcgag
tctggaaatattaatgaaacagagtgggctatttatcaggactggcacacatggcttttg
aatcagtttgaatctgatatagaactggatggcatgatctacctaagaaccacacctgag
aaatgcatggaaaggctacagacgaggggaagggaagaggagcaaggaattgagctcgag
tatttggaaaacctccactataaacatgaaacctggctccatgaaaggactatgagagtt
gattttgagaaccttaaagagattcctattctagttttggatgttaatgaagattttaag
aacgataagattaaacaggagtacctgattgataaagtaagtattaaatgtttcctcatc
tgcctttcttctgtggtaataattcttaagttattgatttacattcttaaaatttaa

DBGET integrated database retrieval system