KEGG   Athene cunicularia (burrowing owl): 113485346Help
Entry
113485346         CDS       T05777                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04020  Calcium signaling pathway
acun04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    113485346 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113485346 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:acun04030]
    113485346 (HTR4)
G protein-coupled receptors [BR:acun04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    113485346 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 113485346
NCBI-ProteinID: XP_026714262
Position
13
AA seq 387 aa AA seqDB search
MEELDVNVSSSEGFGVAEKIVLLTFISAVILMAILGNLLVMVAVCRDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDNWIYGEMFCLVRTSLDVLLTTASILHLCCISLDRYY
AICCQPLVYRNKMTPLRIAVMLGGCWVIPTFISFLPIMQGWNSIGIIDLIQQRQFNKASN
STYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAREHARQIRVLQRAGAPTDGRQ
HHPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFITNIVDPFINYTVPGKLWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILGQTVPCSTTTINGSTHVLRY
AVLRNGHHQEHEKLPIHNDPESQESCF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggaagaacttgatgttaatgtgagttcgagtgagggcttcggcgtagcggagaagatt
gtgctgctcaccttcatctccgccgttatactgatggccatcctggggaacctgctggtg
atggtggccgtgtgccgggacaggcagctcaggaaaatcaagaccaattatttcattgtt
tcccttgcctttgcggacctgctggtgtctgtgctggtgatgccatttggggccattgag
ttagttcaggacaactggatttatggagagatgttctgcctggtccgaacgtccctcgat
gtcctgctcaccacagcgtcaatcctgcacctgtgctgtatctctctggacaggtactat
gctatctgctgccagcctctggtttacagaaacaagatgactccattgcgcatcgccgta
atgcttggagggtgctgggtaatcccaacatttatttctttcctccctatcatgcaaggc
tggaatagcattggcatcattgatctgatccagcaaaggcagttcaacaaggcttccaac
tccacttactgcatattcatggtcaacaagccatacgccattacctgctccgtggtggcc
ttctacattcccttcctcttgatggtgctggcctactaccgcatctacgtcacggccagg
gagcacgcccgacagatccgggtgctgcagcgtgcgggggcccccaccgacggccggcag
caccacccggaccagcacagcacgcaccgcatgaagactgagaccaaagctgccaagacc
ctgtgcatcatcatgggatgcttctgcttgtgctgggcccccttctttatcacaaacata
gtggaccctttcataaactacacggtgccaggaaagctgtggacagctttcctgtggctg
ggctacatcaattcagggttgaaccctttcctctacgccttcctgaacaagtctttcaga
cgtgccttcctcatcatcctgtgctgtggtgatgagcgataccgaaggccttccatcttg
gggcagacggtcccctgttccaccaccacaataaatgggtcaactcatgtactaaggtac
gctgttttacgtaatgggcatcatcaggaacatgagaagcttcccatccacaatgaccct
gaatcccaagagtcctgtttctag

DBGET integrated database retrieval system