KEGG   Athene cunicularia (burrowing owl): 113486340Help
Entry
113486340         CDS       T05777                                 

Gene name
PISD
Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme, mitochondrial isoform X1
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun00564  Glycerophospholipid metabolism
acun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    113486340 (PISD)
Enzymes [BR:acun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     113486340 (PISD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-GeneID: 113486340
NCBI-ProteinID: XP_026715918
Position
15
AA seq 430 aa AA seqDB search
MILKGNLSLSYSAFEDKIVTTLNCLHLYLSSCFLFICSLLTTYNFLIRENLCLRTGVLWK
QPPSRTFFNDRKKLHTAPLGQVFRLRPFHVLVATGGGYAGYKKYEDYKLEQLEKRGIEVP
VKLASEWEVALYKSVPTRLLSRAWGRLNQVELPTWLRKPVYSLYIWTFGVNMKEAAVEDL
HHYRNLSEFFRRKLKPQARPVCCAHSVISPSDGKILNFGQVKNCEVEQVKGVTYSLESFL
GPRISTEELHFRQASPGNSFQQQLVTKEGNELYHCVIYLAPGDYHCFHSPTDWRVSHRRH
FPGSLMSVNPGVARWIKELFCHNERVVLTGDWKHGFFSLTAVGATNVGSIRIYFDQDLHT
NSPSYSKGSYNDFSFISNNNKEGIPMRKGEHLGEFNLGSTIVLIFEAPKDFKFHLKAGQK
IRFGEALGSL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgatacttaaaggaaacttgtccctctcttattcagcttttgaagataagattgtcacc
acactgaactgcttacatttgtacttaagcagctgcttcttgtttatttgcagtttgctg
actacctataacttccttatacgtgagaacctgtgtcttagaactggagtcctgtggaag
cagccaccttctaggacgtttttcaatgacagaaagaagcttcatactgctccgttaggg
caagtctttcgcctgcgccccttccatgttctggtagctacaggtgggggatacgcagga
tacaaaaaatatgaggattacaagttggaacagctggagaagaggggcatagaggtgcct
gtgaagcttgcaagtgagtgggaggtcgctctgtacaaatcggtaccaactcgcctgctc
tcgcgagcctggggccgcctgaaccaagtggagctgcctacatggctgcggaagcctgtc
tacagcctgtacatctggacctttggagtgaacatgaaggaggcggcagttgaagatctg
catcactacagaaacctcagcgaattcttccgcaggaagctgaaaccacaagcacggcca
gtctgctgtgcacacagtgtgattagtccctctgatggcaagatccttaattttggacag
gtaaaaaactgtgaagtggagcaagtaaaaggggttacttattctctggaatctttcttg
ggacctcgcatctccacagaggaattgcattttagacaggcctcacctggtaactctttt
cagcaacaactagtcacaaaggaggggaatgagctctaccattgtgtaatctaccttgcc
ccaggggattatcactgcttccactcacccactgactggagagtgtcacaccgacgtcat
ttcccaggttctctgatgtctgtgaatcctggagttgctcgctggatcaaggaactgttc
tgccacaatgaacgggttgtccttacaggtgactggaaacatggctttttctccttaaca
gctgtaggagcaacaaacgtgggctctatccgcatctactttgaccaggacttgcatacc
aacagtccatcttattctaaaggttcctacaacgacttcagcttcatatccaacaacaac
aaggagggaatccccatgaggaaaggggaacatttaggggaatttaacttaggctctacg
attgtactcatctttgaggcacccaaggacttcaaattccaccttaaagccggacagaaa
atccgctttggagaagcactgggctctctatag

DBGET integrated database retrieval system