KEGG   Athene cunicularia (burrowing owl): 113486351
Entry
113486351         CDS       T05777                                 

Gene name
ADAMTS13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:acun01002]
    113486351 (ADAMTS13)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     113486351 (ADAMTS13)
Peptidases and inhibitors [BR:acun01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   113486351 (ADAMTS13)
SSDB
Motif
Pfam: TSP1_ADAMTS ADAM_CR_2 TSP_1 Reprolysin TSP1_spondin ADAM_spacer1 Reprolysin_4 Reprolysin_5 Reprolysin_3 TSP1_CCN Reprolysin_2 Peptidase_M10 CUB Peptidase_M66 DUF687
Other DBs
NCBI-GeneID: 113486351
NCBI-ProteinID: XP_026715926
Position
17
AA seq 1460 aa
MIVSLTIRALVMLPLGFCWPPAFQEKFLGALDTEDVFSYFGTSSASDVPEFVVAEPSCPC
KEEQIRLMSCHIQHCSIEAWGELYAFEFLEDHALFSSSFVSKQVVNSSFSLLKRFSGNCF
AGGNPLQPPGARCRVTYCEGQLQGVVIADKEKIHIRPVRSKDVALLKDLGFSRPHILFRS
AAREAITARAGRFPSRLQKRAEGAVKHLELMVVAGPDVYSYHKEDTERYILANLNIGAEL
LRDASLGAHFRVHLMQILVLREPEAEVNITTNITSSLISVCEWSKKVNPQNDSDPQHADI
VLYITRFDLELPDGNKELRGVTQLGGVCSSFWSCVITQDTGFDLGVTIAHEIGHSLGIPH
DGEGNRCSRSGYIMGSAGNHNSIDLSWSQCSREEFLAFVSTGQTNCLNDLPDMDGSIPGW
KPGLYYGADEQCKIAFGSVATACTFADSNVDICEVLSCHVQPGDKSSCTRLLVPLLDGTE
CGINKWCFKGQCSSLEELNPMAVVHGQWSVWSPFSSCSRTCGGGVVKRQRFCNNPRPAFG
GQECRGASIQVEMCNTQACLMTQQDFMAEQCAATNVKPLYLTVEAPSFYTWTSAVGFAKG
DMLCKHMCRALESEFMVSREDSFIDGTRCEQDDYEHHGAFNLCVMGSCRAFGCDGQMDSK
KIMDSCRVCGGDNTTCTEVSGSYTEGKAKVYVTFLTLPYNSTLAHVINRRPLFTHLAVKV
KGEYVVAGKGKISLNVTYPSVLEDSQIKYKVFLTKDNLPSLEEVHVDGPTQEEVEIQVYR
RYAKEYGNATNPDITFSYFVPRENLTYMWIPQQGPCSVTCGEGMRPVVHVCFDQTKNEIT
EDQWCLELPQPLSEPKPCVMEPCLYRWKMSHIGECSAVCGTGVAQQNLSCVQFHDGLETV
VDDSLCPAEEKPLSIVPCVVNVCPLGWDKVEDAHLLQTLESLGHIQPENRTVYVWSPLAG
ECSVSCGRGKTQLQYVCVAFDTREETQEENCHPVPKPESRVEVCDLSPCPPRWHYKMGSC
SVSCGGGVMHKVLYCARETGEKAEEIVADTECDGLPHPEEQELCNLELCPPRWKVTPAGS
CSSSCGLGLAVQLVTCVQIHQGKEILLEERLCPVAEKPLNSVPCVIRMCSYEWSFSEWTE
CSTSCGNGIQTRQDFCLNPLTRKHVNPIFCRHFPKAIVVRGCSAGPCPEQTDPLHTGSRG
AGLQTVTPATLTTATTAKEARYKDLDLPPSAVPQEQTKTSGGVCGKLFLNATSIINMTGG
GSGDCAVAIGRPLGEEITVTVLESFLNCSAGEIVLFSGRMMWRTGCRKLPLSLINSRTNT
LIVKQRVLLPGNGVILQYNSRAATKKYYQDCDKQLFGPQGEIVNPVQLPDQRQEVVCRTF
INVAPRHRIAIRAMYIDLDNDSNQTHFNYILVRDVSTMKTMVFHGKQQFFWQSTGSQAEI
EFHENVKDHRISFWAEYHAI
NT seq 4383 nt   +upstreamnt  +downstreamnt
atgatcgtcagcttgacgatccgggcgctcgtgatgctccccttggggttctgctggccg
ccggctttccaagagaaatttctcggcgctttggatacggaagatgttttctcttatttt
ggaaccagctcagcgtctgatgtacctgagtttgttgttgctgagccaagttgcccttgt
aaagaagaacagatccggctgatgtcctgtcacattcaacattgctccattgaggcctgg
ggagaactctatgcctttgaatttttagaggaccatgctctcttttcctcttcctttgtg
agcaagcaagtggtgaactcttcctttagcttactgaagagattctcaggcaactgcttt
gcaggtggaaatccacttcaacctcctggggctaggtgtagagtcacttactgtgagggg
caactgcaaggagtcgtcattgcagataaggagaagattcatatcaggcctgtcagaagc
aaagatgtggccttgctgaaggaccttggcttctccagaccccacattctcttcagaagt
gctgcaagagaggcaattacagcaagagcagggcggtttccttctcgcctgcagaagagg
gctgagggagctgtcaaacatctggagctgatggttgtcgcaggtccagatgtttactcg
taccacaaagaggacacagagcgatatattcttgccaacctgaacattggggcagagctg
ctgagagatgcttcactgggtgctcatttcagggttcatctgatgcaaatacttgttttg
agagaaccagaggcagaggtaaacatcacaacaaatatcacctcctcgttgattagcgtt
tgtgagtggagcaagaaggtcaacccccagaatgactctgacccccaacatgctgatatt
gtcctctacatcaccaggtttgacctggagttacctgatgggaacaaggagctacgtgga
gtgactcagttaggtggagtctgttcctccttctggagctgtgttatcacccaggacact
ggctttgacctgggagtcaccatagctcatgagattgggcacagtcttggaatcccccat
gatggtgaggggaatcggtgcagcaggagcggttacatcatgggttcagcaggaaaccac
aacagcatcgacctctcctggtcacagtgcagccgagaagagttcctggcctttgtcagc
acaggccaaacaaactgcttgaatgacctgccggacatggacggcagcatccctggatgg
aagcctggcttgtactatggagcagatgaacaatgtaaaatagcctttgggagtgttgcc
acagcatgcacctttgctgacagcaatgttgacatatgtgaagttctctcatgccacgta
caaccaggagacaaatccagctgtactcggcttcttgttcccctcttggatggtactgag
tgtggaatcaataagtggtgcttcaagggccagtgcagctctctggaagaactgaacccc
atggctgtggtccatgggcagtggtcggtctggagccccttctcctcctgctcccgcacc
tgcggaggtggagttgtgaaaaggcaacggttctgcaacaaccccaggcctgcttttggg
gggcaggaatgccgtggtgccagcatccaagtggagatgtgcaacactcaggcctgtttg
atgacccagcaggactttatggctgaacaatgtgcagctacaaatgtaaagccactgtat
ctcactgtagaagcaccatccttttatacctggacttctgctgttggctttgccaaaggg
gacatgctctgcaagcacatgtgcagggcccttgaaagcgagttcatggtgagccgcgaa
gacagtttcatagatggaaccagatgtgagcaggatgactatgaacaccacggggctttc
aatctgtgtgtaatgggaagctgcagagcatttgggtgtgatggccagatggactccaag
aagataatggactcttgcagggtctgtgggggtgataatacaacttgcacggaagtgagt
ggatcttacacggaaggaaaagctaaagtgtacgttacatttctgaccctgccttataac
agcaccttggcccatgttatcaatcggaggccactcttcacacatttggctgtgaaggtt
aaaggagagtatgtggttgctggaaaaggaaaaatctcactgaatgtcacctatccgtca
gttctggaggacagccagatcaaatacaaagtgtttctcaccaaggacaacctgccaagc
ctggaggaagtccatgtggatgggccaacacaagaagaagttgaaatacaggtctatcga
aggtatgcaaaagaatacggcaatgccaccaacccagacatcaccttcagctactttgtc
cccagagagaatctgacatatatgtggattcctcagcaggggccctgttcagtgacctgt
ggggaagggatgcgaccagtggttcatgtgtgctttgaccagacaaagaatgaaataaca
gaggatcagtggtgtctggagctcccacagcccctttcagagcccaagccctgtgtcatg
gagccatgcctgtacaggtggaagatgtctcacataggtgagtgctctgctgtctgtgga
actggagttgcccagcagaatctgtcctgtgtacagtttcacgatggattggagactgtt
gtggatgacagcttgtgcccagcagaagaaaaacccctctccattgtgccgtgtgtggtt
aatgtctgccctttaggctgggacaaagtggaagatgcacacttacttcagactttggag
tcacttgggcatatccaaccggaaaatcggactgtgtatgtctggagccctctagctgga
gagtgttccgtctcctgtgggagaggtaagactcagctacagtatgtatgtgtggctttt
gacactagagaagaaacccaggaagaaaactgtcatccagtgccaaagccagagagcagg
gtggaagtctgcgatctcagtccctgcccaccaaggtggcattacaaaatgggctcatgc
agtgtaagctgtggaggaggtgtgatgcacaaagtcctctactgtgcaagggagacgggg
gagaaggcagaagagattgtggcagacacagagtgtgatggtttgcctcacccagaggag
caggagctgtgtaatttggagctgtgccctccaaggtggaaggtaaccccagctggctcc
tgttcctccagctgtgggctcggcttagctgttcagctggtcacctgtgtgcagattcac
caaggcaaggagattttgctggaggagcgtttgtgtcctgtggcagagaagccccttaac
agtgtcccttgtgtcattcgaatgtgctcttatgaatggagcttcagcgagtggacagag
tgttcaacttcgtgtgggaacggcattcagacacggcaggatttctgcctcaacccgcta
acccgtaagcacgtgaaccccatcttctgcagacacttccccaaggccattgtggtacgt
ggctgctccgcggggccctgccccgagcagacagaccccctgcacaccgggtcccgtgga
gcaggactgcagacagtgacaccggccacgctgacgacggccacgaccgccaaggaggcg
aggtacaaggacctggatcttcctccatctgctgtgcctcaggagcagacaaagaccagt
ggaggtgtctgtggaaagctctttcttaatgccaccagcatcatcaacatgacgggtgga
gggagcggtgactgcgctgtggccatcggacgtcctctgggggaggagatcacagtcact
gtcctggagagcttcctcaactgcagcgcaggtgagatagtgctgttttctgggcgaatg
atgtggcggacaggctgcaggaagctccctttgtcactgataaattccagaacgaacacg
ctgattgtgaaacagcgtgttttgctgccaggaaatggggtcattcttcagtacaacagc
agagctgcaactaaaaagtattaccaagactgtgacaagcagctgtttggtccccaaggt
gaaatagtgaatcctgtgcaactgcctgatcaaaggcaagaagtggtgtgtcggaccttc
atcaacgtggctccccgacatcgcatagctatccgtgccatgtatattgacctggacaat
gacagcaaccaaacacattttaattacatcctggtccgtgacgtaagcaccatgaagaca
atggtgttccatgggaaacaacaattcttctggcaatcaacaggaagccaagctgaaatt
gaatttcatgaaaatgttaaggatcaccgaatcagtttctgggctgaatatcatgctatt
tag

DBGET integrated database retrieval system