KEGG   Athene cunicularia (burrowing owl): 113487532Help
Entry
113487532         CDS       T05777                                 

Gene name
CHRNA4
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    113487532 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acun04040]
    113487532 (CHRNA4)
Ion channels [BR:acun04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   113487532 (CHRNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 113487532
NCBI-ProteinID: XP_026717987
Position
20
AA seq 624 aa AA seqDB search
MGFLVSKGNLLFLLCASVFPAFGHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVR
FGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVL
YNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD
KAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLF
YTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPL
IGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRIFLDIVPRLLFMKRPSAVK
DNCKKLIESMHKITNTPRLWSELDAEPNFTTSSSPSPQSNDPSPTSSFCAHLEEPAKPQP
VCKSPSGQYSVLHPEPVQVTCPSPQPSCHPLSDTQTTSILKGRSLSVQQMYSPHKAEEGN
IRCRSRSIQYCYLQEDSSQTNGQSTGSPASQRCHLNEEQPQNKPSQCKCKCKRSEAAGTP
AQGSKNHNAKEQHLVLMSPALKLAVEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFL
WMFIIVCLLGTVGLFLPPWLAGMI
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atgggatttctcgtgtctaaaggaaacctccttttcctgctgtgtgccagcgtcttcccc
gccttcggccacgtggaaacccgagcccacgcggaggagcgtctcctgaagaaactcttc
tctggttataacaagtggtcccgccccgtcgccaacatttctgatgtggtcctcgtccgc
ttcggcttgtccattgcccagctcatcgatgttgatgagaaaaatcaaatgatgaccacg
aacgtgtgggtgaagcaggagtggcacgactataagctacgctgggacccccaggagtat
gaaaatgtcacatccatccgaatcccctcggagctcatctggaggccggatatcgtcctc
tacaacaatgctgacggtgactttgcagtcacccacctgaccaaggcccacctcttctat
gatgggagaattaaatggatgccacctgctatctataaaagctcctgcagcatcgatgtg
accttcttcccctttgaccagcaaaactgcaccatgaagtttggctcctggacctatgac
aaagccaagatagacctggtgagcatgcacagtcatgtggaccagctggactactgggag
agcggggaatgggtcatcatcaacgctgtgggcaattacaacagcaagaaatatgaatgc
tgcacagaaatctacccggatataacttactccttcattatccggaggctgccactgttc
tacacaatcaacctgatcatcccctgcctgctaatctcctgcctgactgtcctggtcttc
tacctgccctctgagtgtggagagaagataactttgtgcatctccgtgctgctgtccctc
actgtgttcctgctgctcatcacggagatcatcccctctacctccttggtcatccctctg
attggagagtatcttctcttcaccatgatattcgttaccttgtctattatcatcactgtc
tttgtgctcaacgtgcaccatcgttccccacgcacccacacgatgcccgactgggtgagg
aggatcttccttgacatagtcccacgcctcctcttcatgaaacgtccctctgcagtgaaa
gacaattgcaagaagctcattgaatccatgcacaaaataaccaatacaccaaggctttgg
tccgagctcgatgcggaacccaacttcactacctcatcttcccccagcccccagagtaat
gatccatcacccacctcttccttctgtgcccacctcgaggagccggccaagcctcagccc
gtctgcaagtccccttctgggcagtactctgtgttgcacccagagcctgtacaggtgacc
tgcccctctccacaaccctcgtgccaccccttgagtgacacccagaccacctccatcttg
aaaggcagatcgctaagtgttcagcagatgtacagcccccataaggcagaggaagggaat
atccgctgtaggtcccggagtatccagtattgctacttgcaggaggactcttcccagacc
aatggccaatccactggctctccagcatcccagcggtgccacctaaatgaagagcagccg
cagaacaagccctctcagtgcaagtgtaaatgcaaaaggagcgaggcagctggcacacca
gctcaaggaagcaagaatcacaacgccaaagagcaacatcttgtgctgatgtccccagcc
ctgaagctggcagtggaaggggttcactacatcgcggaccacctgcgggcagaagatgcg
gatttctcagtgaaggaagactggaagtacgttgcaatggtcattgacaggatcttcctc
tggatgttcatcattgtgtgtttgctgggaactgttggtctcttcctcccaccatggctg
gcagggatgatttaa

DBGET integrated database retrieval system