KEGG   Athene cunicularia (burrowing owl): 113489131Help
Entry
113489131         CDS       T05777                                 

Gene name
CNP
Definition
(RefSeq) 2',3'-cyclic-nucleotide 3'-phosphodiesterase
  KO
K01121  2',3'-cyclic-nucleotide 3'-phosphodiesterase [EC:3.1.4.37]
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acun04147]
    113489131 (CNP)
Enzymes [BR:acun01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.37  2',3'-cyclic-nucleotide 3'-phosphodiesterase
     113489131 (CNP)
Exosome [BR:acun04147]
 Exosomal proteins
  Exosomal proteins of oligodendrocytes
   113489131 (CNP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CNPase Zeta_toxin 6PF2K AAA_14 AAA_33 AAA_22 CPT AAA_5 AAA_16 ABC_tran AAA_18 AAA NB-ARC KAP_NTPase AAA_30 AAA_17 NACHT KTI12 AAA_29 tRNA_lig_kinase TK IstB_IS21 RNA_helicase Viral_helicase1
Motif
Other DBs
NCBI-GeneID: 113489131
NCBI-ProteinID: XP_026720451
Position
27
AA seq 403 aa AA seqDB search
MSAQSAKERPESLQFPFLDDEDTISTVKESKTFFILRGLPGSGKSTLAQAIQDRYKDACK
VVSVDSYKITPLIRSTVPEEYSKVDEDLVDYCKRDISVIVLDDTHHERERLDQLFDIADK
YRYKVIFAEPKTQWRMDCLQLKEKNQWKLSVDELKKMKPSLEKEFLPMYFGWFLSKRSSE
ILRKAGQAFLDELGSLKAFKKESKYFASAIEDPKIKIDLTSYFVKRPPGVLHCTTKYTDF
GKAAGAEEYAQQEAVKASYGKGFTLAISALFVTTKTVGARVELSEQQLLLWPGDADKILP
AESLPRGSRAHVTLGCANSVEAVQTGLDLLEFVKLEKAGNKGEEVGEIGGGKLLYFGNGM
WMLILSKKIDVKAIFSGYYGKGKLVPTQSTNKRGSAFSSCTII
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcagtccgcgaaagaaagacccgaaagcttgcagttccctttccttgacgat
gaagacaccatctccacagtcaaagaatctaaaaccttttttattttaaggggcctgccg
ggcagtgggaagtccactctggcccaggcaattcaggataggtataaagatgcctgcaag
gtcgtctcggtcgatagctataaaatcacaccgttaataagaagcaccgtgcctgaagag
tactcaaaggtggatgaggatctagttgactattgcaaacgagacatcagcgttatcgtt
ttggatgacactcaccatgagagggaacgactggaccaactctttgatattgctgacaaa
taccggtacaaagtcatctttgctgagcccaaaacccagtggcggatggattgtttgcag
ctgaaggaaaagaaccagtggaaactgtcggtggacgagctgaagaagatgaagccgagc
ttggagaaggaattcctacccatgtattttgggtggtttttgagcaaaagaagttcagag
atcctgaggaaggctggccaggccttcttagatgagcttggaagtctcaaagccttcaaa
aaggagagtaaatactttgcttctgctattgaagaccccaaaataaaaatagatctgacc
agctacttcgtgaagaggccgcccggggtcttacactgcaccacaaaatacacagacttt
ggaaaagcagctggagccgaggagtacgcacagcaggaggcggtgaaggcttcctacggc
aaaggcttcaccttggccatctctgctctcttcgtcaccacaaaaactgttggggctcgc
gtagagctgagcgagcagcagctgctgctgtggcctggggacgccgacaagatcctgccc
gccgagagcctcccgcggggcagccgggcccacgtcaccctcggctgcgccaacagcgtc
gaagccgtccagaccgggctggatctgctggagtttgtgaaactggaaaaggcagggaac
aaaggggaagaagtgggagaaattggaggagggaaactgctgtattttggtaacggtatg
tggatgctcatcctgtctaaaaagatcgatgtgaaggcaatattctcgggttactatgga
aaaggaaaactcgtgcccacgcagagcaccaacaaacggggctctgccttcagctcctgc
accatcatctag

DBGET integrated database retrieval system