KEGG   Athene cunicularia (burrowing owl): 113491048
Entry
113491048         CDS       T05777                                 

Gene name
ASIC1
Definition
(RefSeq) acid-sensing ion channel 1
  KO
K04829  acid-sensing ion channel 1
Organism
acun  Athene cunicularia (burrowing owl)
Brite
KEGG Orthology (KO) [BR:acun00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:acun04040]
    113491048 (ASIC1)
Ion channels [BR:acun04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   113491048 (ASIC1)
SSDB
Motif
Pfam: ASC DUF4074
Other DBs
NCBI-GeneID: 113491048
NCBI-ProteinID: XP_026723480
Position
Unknown
AA seq 527 aa
MMDLKVDEEEVDSGQPVSIQAFASSSTLHGLSHIFSYERLSLKRVVWALCFLGSLALLAL
VCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLN
NRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQC
TPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDET
SFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKAVAGDSEF
YDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYC
VCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIE
QKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDYAYEVIKHRLCRRGKCRKNHKRNNTD
KGVALSMDDVKRHNPCESIRGHPAGMTYAANILPHHPARGTFEDFTC
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgatggacctgaaggtggacgaggaggaggtggacagcgggcagccggtgagcatccag
gccttcgccagcagctccaccctccacgggctctcgcacatcttctcgtacgagcggctg
tcgctgaagcgcgtggtctgggcgctgtgtttcctgggctcgctggcgctgctcgccctc
gtctgcaccaaccgcatccagtactacttcctctacccccacgtcaccaaactggacgag
gtggcggccaccaggctcaccttccccgccgtcaccttctgcaacctcaacgagtttcgt
ttcagccgggtgaccaagaacgacctgtaccacgccggcgagctcctcgccctgctcaat
aacagatacgagatcccagacacccaaacggccgacgagaagcagctggaaatcctgcag
gacaaggcaaacttccgaaacttcaagcccaaacctttcaacatgctggagttttacgac
cgggctggccacgacatccgggagatgctgctgtcctgcttcttccgcggggagcagtgc
acccccgaagacttcaaagtggttttcacccgctacgggaagtgctacaccttcaacgcg
gggcaggacgggaagccccggctcatcaccatgaaggggggcaccggcaacggcctggag
atcatgctggacattcagcaggacgagtacctgccggtgtggggggaaacagacgagacc
tcattcgaagccgggatcaaggtgcagatccacagccaggatgagcccccgctgatcgac
cagctgggcttcggggtggctcccggcttccagaccttcgtgtcctgccaggagcagcgg
ctcatctacctgccgcctccctggggcgactgcaaggccgtggcgggtgactcggagttt
tacgacacctacagcatcacggcctgtcgcatcgactgcgagacccgctacctggtggag
aactgcaactgccgcatggtgcacatgccaggcgatgccccttactgcaccccggagcag
tacaaggagtgcgcggatccggccttagatttcctggtggaaaaggacaacgagtactgc
gtctgcgagatgccctgcaacgtgacgcgctacggcaaagagctctccatggtgaagatc
cccagcaaggcctccgccaagtacctggccaagaagtacaacaaatcggagcagtacatc
ggggagaacatcctggtgctggatatcttctttgaagccctgaactatgagacgatcgag
cagaagaaggcgtacgaggtggccggcttgctgggtgacatcggagggcagatggggctg
ttcattggggccagtatcctcacagtactggagctgttcgactacgcctacgaggtgata
aagcaccggctgtgccggcggggcaagtgccgcaagaaccacaagaggaacaacacggac
aagggcgtcgcgctgagcatggacgacgtgaaacgccacaatccctgtgaaagcatacgg
ggccacccggcaggcatgacgtacgcagccaacatcctacctcatcacccggcccggggc
acctttgaggacttcacctgctaa

DBGET integrated database retrieval system