KEGG   Athene cunicularia (burrowing owl): 113491571Help
Entry
113491571         CDS       T05777                                 

Gene name
TNFRSF13C
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 13C isoform X1
  KO
K05151  tumor necrosis factor receptor superfamily member 13C
Organism
acun  Athene cunicularia (burrowing owl)
Pathway
acun04060  Cytokine-cytokine receptor interaction
acun04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:acun00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    113491571 (TNFRSF13C)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    113491571 (TNFRSF13C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:acun04050]
    113491571 (TNFRSF13C)
   04090 CD molecules [BR:acun04090]
    113491571 (TNFRSF13C)
Cytokine receptors [BR:acun04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   113491571 (TNFRSF13C)
CD molecules [BR:acun04090]
 Proteins
  113491571 (TNFRSF13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BaffR-Tall_bind
Motif
Other DBs
NCBI-GeneID: 113491571
NCBI-ProteinID: XP_026724404
Position
1
AA seq 237 aa AA seqDB search
MSPGHCDFVLGWPLHHRAMRDLGSHSTMPSSGKAVAASSCLSPQCFDLLTKSCVKCSDLF
KDNTTEPARMVPTSTPAPTLTSVDLPSTLLIFGVPAAVGLILSLAAFLGFLACKVGKRRK
KRKAVDKEAEANMDATSPLPSLGCQDPAVPEGDAALAPTPCLHLNGSLKMLEPPEKPGAK
RRPCCQGDADDDIILLSTMYPQHEECNHGLPLPATELGATALVTTKTTQKCTGEETA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgtccccggggcactgcgatttcgtactcgggtggccccttcatcatcgcgccatgcgt
gatctgggctcccattccaccatgccctcgtcaggaaaagccgtcgctgcctcctcctgc
ctctccccccagtgcttcgacctcctgaccaagtcctgcgtaaagtgctctgacttgttc
aaggacaacacaacagagcccgcccgcatggtgcccacctctaccccggcacccaccctc
acctcagtggacctgcccagcaccctcctgatctttggggtccctgcagcggtggggctc
atcctgtctctggctgccttcttgggcttcctggcctgcaaagtggggaagaggaggaag
aagaggaaggcggtggacaaggaggctgaagcaaacatggatgccacaagccccctgccc
agcctgggctgccaggaccctgctgtgccagaaggagatgctgccctggccccaactccg
tgcctacatctcaacggaagcctgaagatgctggagccacctgagaaacccggggcaaag
cggaggccatgctgccagggtgatgccgatgacgacatcatcctgctctccactatgtac
ccccagcatgaggagtgcaaccacggtctcccgctgcccgccaccgagctgggggccacg
gccctggtcaccaccaaaaccacgcagaaatgcactggagaggagacagcctga

DBGET integrated database retrieval system