KEGG   Acinetobacter sp. TGL-Y2: AMD27_00690Help
Entry
AMD27_00690       CDS       T04425                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00480  Glutathione metabolism
acv00590  Arachidonic acid metabolism
acv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    AMD27_00690
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMD27_00690
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AMD27_00690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AMW80289
UniProt: A0A143G7S1
Position
complement(164230..164772)
Genome map
AA seq 180 aa AA seqDB search
MASVYNIPVNTIQGEAVDLSQYAGKVLLIVNVASKCGLTPQYEGLEKLYTDKKAEGLEIL
GFPANNFLAQEPGSNENIQEFCSLTYNVDFPLFAKISVAGEDKHPLYATLTQAVPERIGE
GPWWKDLVDYGLTPNPKPEVLWNFEKFLINKQGEVVARFAPDITADDARIVDAIHAELAK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggtatacaatattccagtgaacaccattcaaggtgaagcagtcgatttaagc
caatatgcgggcaaagttttattgatcgtcaatgtcgcgtcaaaatgcggtttaacaccg
cagtacgaaggtttagaaaaactttataccgacaaaaaagctgaaggcttagaaatttta
ggtttcccagcaaacaatttccttgcgcaagaacctggcagcaatgaaaatattcaagaa
ttttgctcgcttacctataacgtagactttcctctctttgccaaaatttcagtggcaggt
gaagacaaacacccactctatgcaaccttaactcaagctgtacctgaacgtataggtgaa
ggtccttggtggaaagatttggtcgattatggtttaacaccaaatccaaaacctgaagta
ctgtggaattttgaaaaattcttaatcaataaacaaggtgaagtggtcgcgcgttttgca
cctgatattacggcagatgatgcgcgtatagtcgatgcgattcatgctgaacttgcaaaa
taa

DBGET integrated database retrieval system