KEGG   Acinetobacter sp. TGL-Y2: AMD27_05500Help
Entry
AMD27_05500       CDS       T04425                                 

Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00860  Porphyrin and chlorophyll metabolism
acv01100  Metabolic pathways
acv01110  Biosynthesis of secondary metabolites
acv01120  Microbial metabolism in diverse environments
Module
acv_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AMD27_05500
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acv01007]
    AMD27_05500
Enzymes [BR:acv01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AMD27_05500
Amino acid related enzymes [BR:acv01007]
 Aminotransferase (transaminase)
  Class III
   AMD27_05500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMW78390
UniProt: A0A143G2E4
Position
1180175..1181473
Genome map
AA seq 432 aa AA seqDB search
MTLSAKQEQLFKQASKHIPGGVNSPVRAFNGVGGTPVFIEKAQGAYLYDVDGKRYVDYVG
SWGPMILGHAHPTIIKAVQEAAVDGLSFGAPTVHETTLADIICEIMPSIELVRMTNSGTE
ATMTAIRLARGYTGRDKIVKFEGNYHGHSDSLLVKAGSGLLTSGEGEATSAGVPADFAKH
TLTLPYNDIATLKECFAKFGSQIAGVIVEPVAGNMNLVKPIDGFLQAIRDVCDEHGSVFI
IDEVMTGFRVGLGGAQAHYGVTPDLTTLGKIIGAGLPVGAFGGKREVMECIAPLGKVYQA
GTLSGNPLAMRAGIEMFKHLRAEGFYENLTAQLEKLLAGLQAAADEAGIAFKTQQVGGMF
GLYFTDQTDITSFDSMLKCDVEMFRKFFHGMLEQGVNLAPSAFEAGFISSAHSDEDIAYT
IQAAKTVFARIK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgactttatctgccaagcaagaacaattgtttaaacaagccagcaaacacattccaggt
ggagtgaactcacctgtacgcgcatttaatggcgtgggtggtaccccagtgtttatcgaa
aaagcacaaggtgcttatttgtatgatgtggatggtaagcgttacgtagactacgtcggt
tcttggggtccaatgatcttaggacatgcacatcctacgattattaaagccgtgcaagaa
gcagcggttgacggattaagctttggtgcgccaacagttcatgaaaccacacttgcggat
atcatttgtgaaatcatgccttctattgaattggtccgtatgaccaactcaggtacagaa
gcaaccatgacggcaattcgccttgctcgtggttataccggtcgtgacaagattgtaaaa
tttgaaggtaactaccacggtcattcagactcattattggtaaaagcaggttctggattg
cttaccagtggtgaaggtgaagcgacttctgcaggtgtacctgcagattttgcaaaacat
actttaacgcttccgtacaatgacatcgcaacattaaaagaatgcttcgcgaagtttggt
tcacagattgcaggtgtcatcgttgagcctgtggcaggcaacatgaacttggtgaagccg
attgatggtttcttacaagcgattcgtgatgtttgtgatgaacatggttcagtgtttatc
attgatgaagtgatgaccggttttcgtgttggtctgggcggcgcacaggcacattatggc
gtaacaccagacttaaccactttgggtaaaatcattggggcagggcttccagtaggtgct
tttggtggtaaacgtgaagtgatggaatgcattgcaccactgggtaaagtctatcaagca
ggaacgttgtcaggtaatccactggcaatgcgtgcagggattgaaatgtttaagcattta
cgtgctgaaggcttttatgaaaacttaactgcacaactggaaaagctactcgcgggttta
caagcagcagcagatgaagcgggtattgcatttaaaactcagcaagttggtggaatgttt
ggtttgtatttcacagatcaaacagacattaccagctttgattcaatgttaaaatgcgat
gttgagatgttccgtaaatttttccacgggatgcttgaacagggcgtaaatcttgcaccg
tctgcatttgaagctggatttatctcaagtgcgcattcagatgaagatattgcgtataca
attcaagcagctaaaacggtatttgcacgtataaaatag

DBGET integrated database retrieval system