KEGG   Acinetobacter sp. TGL-Y2: AMD27_06085Help
Entry
AMD27_06085       CDS       T04425                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:acv00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AMD27_06085
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:acv01007]
    AMD27_06085
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:acv03016]
    AMD27_06085
Enzymes [BR:acv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AMD27_06085
Amino acid related enzymes [BR:acv01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AMD27_06085
Transfer RNA biogenesis [BR:acv03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AMD27_06085
 Prokaryotic Type
    AMD27_06085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f tRNA-synt_1c ApoLp-III rve_3
Motif
Other DBs
NCBI-ProteinID: AMW78497
UniProt: A0A143G2U3
Position
1312541..1313962
Genome map
AA seq 473 aa AA seqDB search
MQPFVLYNSEQRKKVEFVPRVEGHIDMYVCGMTVYDYCHIGHARVMVAFDYIIRFLRSQG
WSVKYVRNITDIDDKIIKRAHENGESITALTDRFIQAMNDDAESLGCARPDEAPRATDYI
DQMQSMIGTLVNKGTAYASDNGDVYFEVEKFAKYGRLSGRKLEDMQAGASERVDVEVQKK
HPFDFVLWKHAKENEPAWASPWGNGRPGWHIECSAMSTCCLGNHFDIHGGGSDLTFPHHE
NEIAQSEASTGEQYVNYWMHVGFINVDGEKMSKSLGNFFTIRDVMEKFHPEVIRYFIVSS
HYRSPVNFSDTALKEAKNTLSRFYHSFKAYQQTYGTDVVAVYDETLVERFNAAMRDDFNT
SEAIAVLFEVNKELNRAVKDQNIEQAAVYYATLRHLTDILGLVQHNVDDFLKSDIGQDTL
DLSGNEIEALIQQRVEAKKAKEFAKADEIRQSLLDQGVVLEDTRQGTIWRRAD
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccatttgttctttacaactcagagcaacgtaaaaaagtagaattcgtgccacgt
gtcgaaggtcatatcgacatgtatgtctgtggaatgacagtctatgattactgtcatatt
ggacatgcgcgtgtcatggttgcatttgactatattattcgttttctacgtagccaaggc
tggagtgttaaatacgtccgtaatattaccgatattgacgacaaaattattaaacgtgcc
catgaaaatggcgaaagtattaccgcattgacggatcgttttattcaagccatgaatgat
gatgccgaaagtctgggctgtgcgcgcccagacgaagcaccacgtgcaacagactatatt
gatcaaatgcaaagtatgattggtacgcttgtcaataaaggcacagcctatgcctctgac
aatggcgacgtgtatttcgaagttgaaaaatttgctaagtatggtcgcttatctggtcgt
aagctcgaagacatgcaagcaggcgcatctgagcgtgtcgatgtggaagtgcaaaagaaa
catccgtttgacttcgtcctttggaaacatgccaaggaaaatgagccggcatgggcttca
ccttggggtaacggtcgtccaggctggcacatcgaatgttctgcaatgtcgacctgctgc
ttggggaatcattttgatattcatggtggcggatcagacttaacttttccacatcatgaa
aatgaaattgcccagtcggaagcatctacgggcgaacagtatgtcaattattggatgcat
gtgggtttcatcaatgttgatggtgaaaaaatgtcgaagtcacttggcaacttcttcacc
attcgtgatgtgatggagaaattccatcctgaagtgattcgttactttattgtgtcatca
cattatcgtagcccagtgaatttctcggatacagcgcttaaagaagcaaaaaataccttg
tctcgcttctaccattcatttaaagcctatcagcaaacctatggcacagacgttgttgct
gtatatgatgaaactttggtcgagcgttttaatgcagccatgcgtgatgactttaatacc
tcagaagccattgcggtgctctttgaagttaataaagagctcaaccgtgctgtcaaagat
caaaatattgaacaagctgcggtttattacgctacccttcgtcatttgactgatattcta
ggtttggtgcagcacaatgtagatgatttcttaaagtcagacattggtcaagacacccta
gatttatcgggtaatgagattgaagcactgattcaacagcgtgtagaggctaaaaaagcc
aaagaatttgctaaagcagatgaaattcgtcaatctttactcgatcaaggtgtggtgctt
gaagatacacgtcaaggtacaatttggcgacgtgctgattaa

DBGET integrated database retrieval system