KEGG   Acinetobacter sp. TGL-Y2: AMD27_06735Help
Entry
AMD27_06735       CDS       T04425                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00010  Glycolysis / Gluconeogenesis
acv00053  Ascorbate and aldarate metabolism
acv00071  Fatty acid degradation
acv00280  Valine, leucine and isoleucine degradation
acv00310  Lysine degradation
acv00330  Arginine and proline metabolism
acv00340  Histidine metabolism
acv00380  Tryptophan metabolism
acv00410  beta-Alanine metabolism
acv00561  Glycerolipid metabolism
acv00620  Pyruvate metabolism
acv00625  Chloroalkane and chloroalkene degradation
acv00903  Limonene and pinene degradation
acv01100  Metabolic pathways
acv01110  Biosynthesis of secondary metabolites
acv01120  Microbial metabolism in diverse environments
acv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMD27_06735
   00053 Ascorbate and aldarate metabolism
    AMD27_06735
   00620 Pyruvate metabolism
    AMD27_06735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMD27_06735
   00561 Glycerolipid metabolism
    AMD27_06735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMD27_06735
   00310 Lysine degradation
    AMD27_06735
   00330 Arginine and proline metabolism
    AMD27_06735
   00340 Histidine metabolism
    AMD27_06735
   00380 Tryptophan metabolism
    AMD27_06735
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMD27_06735
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMD27_06735
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AMD27_06735
Enzymes [BR:acv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AMD27_06735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMW78609
UniProt: A0A143G304
Position
1459144..1460586
Genome map
AA seq 480 aa AA seqDB search
MQCYSFNNAQYIAGKWIQGTSTHVIKNINPFNQATILDLQAASTIDVDAAYAAAQKAFGT
WSKTDAIARKNLVERVADIMSKRRAEIVDLLIQESGSTRLKANIEVEAALAIIRESATFP
SRLLDSKLKSPDPQRHSWVYKKALGVIAVISPWNFPFHLSMRSVVTAIAIGNSVVLKPAS
DTPITGGLLLAKIFEEAALPVGVLSVLAGSGREIGDYFVEHAIPKLISFTGSTEVGQGVA
KIAVSGAHLKRVALELGGNAPLVVLDDADLDLAVELTVMGRFLHQGQICMSTNRVIVDAQ
IYEAYVEKLIARAKQISFGDPTLEATLIGPIINADQVAKIKEIIHKAVSKGTKLALGGDI
VGNVIPPHIFIDVDPKSELAQEESFGPVLPVIKARDEAHALELANDTRFGLSSAVCTSNK
ERGLAFALSIDAGMTHINAISVADDPTAPFGGEKNSGLGRFNGHWILEEFSRTHWVTIDK
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgttatagctttaataatgcgcagtatattgccggaaaatggattcagggcaca
tcaacgcatgtgataaaaaatataaatccttttaatcaagccacgattttagacttacaa
gcggcaagtacaatagacgtggatgctgcgtacgccgcagcgcaaaaggcttttggcaca
tggtcaaaaaccgatgctatagcgcgaaaaaatttagtcgaacgcgtggcggatattatg
tctaagcgccgtgctgaaattgtggatttactgatacaagaatcgggcagcacccgttta
aaggctaatattgaagttgaggcggctttagcgattatccgtgaatctgcaacattccca
agccgattgctggatagcaaattaaaatctcctgacccacagcgtcatagctgggtctat
aaaaaagcattgggcgtaattgcggtgattagtccttggaattttccgtttcatttgagc
atgcgctcagttgtgactgcgatcgccattggcaatagtgtggtgctgaaacctgccagc
gatacgcctattacaggcggattacttttggctaagatttttgaagaagcagcattgcca
gtaggtgtgctgagtgtgctcgcaggttcaggacgtgaaataggggactattttgtcgag
catgctatacctaaattgatttcatttactgggtcaaccgaagttggacaaggtgtggct
aaaattgctgtaagtggagcacatttaaaacgcgtggctttagagctaggtggtaatgcg
ccacttgtcgtgcttgatgatgcagatttagatttggccgttgaactcaccgtcatgggg
cgttttttacatcaaggtcaaatctgtatgagtaccaaccgtgtgattgtagatgcacag
atttatgaggcttatgtagaaaaattaattgcacgtgcaaaacaaatttcttttggagat
ccgacattagaggcaacactgataggtcccattattaatgctgatcaagttgcaaagatt
aaagagatcattcataaagccgtttcaaaaggcactaaacttgctttaggtggtgatatt
gttggcaatgtgattccaccgcatatttttatagacgtagacccaaaatcagaacttgct
caagaagaaagttttggacctgtactacctgtaattaaggcacgagatgaagcacatgct
ttagaactcgccaatgacacccgatttggactttctagtgccgtgtgtacctcaaataaa
gaacgcggtttggcatttgccttaagtatagatgccgggatgacccatatcaatgcgatt
tcggttgcagatgatcctactgcaccttttggtggggagaagaattctggactcgggcgt
ttcaacgggcactggattttagaagagttcagccgtacgcattgggtgaccattgataaa
taa

DBGET integrated database retrieval system