KEGG   Acinetobacter sp. TGL-Y2: AMD27_07140Help
Entry
AMD27_07140       CDS       T04425                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00071  Fatty acid degradation
acv00072  Synthesis and degradation of ketone bodies
acv00280  Valine, leucine and isoleucine degradation
acv00310  Lysine degradation
acv00362  Benzoate degradation
acv00380  Tryptophan metabolism
acv00620  Pyruvate metabolism
acv00630  Glyoxylate and dicarboxylate metabolism
acv00640  Propanoate metabolism
acv00650  Butanoate metabolism
acv00900  Terpenoid backbone biosynthesis
acv01100  Metabolic pathways
acv01110  Biosynthesis of secondary metabolites
acv01120  Microbial metabolism in diverse environments
acv01130  Biosynthesis of antibiotics
acv01200  Carbon metabolism
acv01212  Fatty acid metabolism
acv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMD27_07140
   00630 Glyoxylate and dicarboxylate metabolism
    AMD27_07140
   00640 Propanoate metabolism
    AMD27_07140
   00650 Butanoate metabolism
    AMD27_07140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AMD27_07140
   00072 Synthesis and degradation of ketone bodies
    AMD27_07140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMD27_07140
   00310 Lysine degradation
    AMD27_07140
   00380 Tryptophan metabolism
    AMD27_07140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMD27_07140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMD27_07140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AMD27_07140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:acv04147]
    AMD27_07140
Enzymes [BR:acv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMD27_07140
Exosome [BR:acv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMD27_07140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AMW78680
UniProt: A0A143G385
Position
complement(1521995..1523521)
Genome map
AA seq 508 aa AA seqDB search
MSKTTQENPTVENSAKETVSNTSKTRSNTSKSTASTPQLANTQKTSNPRSTSSRRKTQTS
NTKKAESTALTTTQSAVPQDNTMSQTTIRRVAIIGGNRIPFARSNGAYFQASNSDMLTAA
LNGLVERFGLHGQRLGEVVAGAVLKHSRDFNMTRECVLDTELAPETPAYDIQQACGTGLQ
AAFSVANKIALGQIDVGIAGGVDTTSDAPIAFGDGLRKALLELNIAKTAKDRLKALTKIN
VKDLLDAPKNGEPRTGLSMGDHQAITTLEWGISREAQDELAAKSHQNMAKAYEEGFFDDL
ITPFLGLERDNNLRPDSSVEKLAKLKPAFGKGDARTMTAGNSTPLTDGASVVLLASEEWA
KANGHEVLAYLSFSETAAVDFIGKKEGLLMAPAYAVPRMLERAGLKLQDFDYYEIHEAFA
SQVLSTLKAWEDPKFCKERLGLDAPLGSIDRTKLNVKGSSLAAGHPFAATGGRIIASAAK
LINQKGSGRVLVSICAAGGQGVTAIIEK
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacaactcaagaaaatccaacagtcgagaattctgcgaaagaaacggtgtca
aatacgtcaaaaactcgttcaaatacgagtaaaagtaccgcatcgactccacagctcgca
aatactcaaaaaacgtctaatccccgttctacgtcatcacgtcgtaaaacccagacttca
aatacaaaaaaagctgaatcgacagctttaacgactactcaatctgctgttccacaggat
aatactatgagtcaaactactattcgccgtgtggctattattgggggaaatcgtattccc
ttcgctcgctcaaatggtgcgtattttcaagcctccaactcagacatgctcactgcagcg
ttaaatggtttggtagaacgctttggtttacacggtcaacgtttaggtgaagtggttgca
ggtgctgtgcttaaacatagccgtgattttaatatgacccgtgaatgtgtactggacact
gaacttgcaccagaaacacctgcatatgacatccaacaggcttgtggtacaggtctacaa
gcggcattttctgtggccaataaaattgcactcggtcaaattgacgtgggtattgcaggc
ggtgtggataccacctcagatgcccctatcgcatttggcgatggcttacgtaaagctctg
cttgagctgaacattgccaagacagctaaagatcgtctaaaagccttgaccaaaattaat
gtcaaagatttgcttgatgcaccaaaaaatggtgaaccacgtacaggtctatcgatgggt
gaccatcaagcgattaccacccttgagtggggtatttctcgtgaagcacaagatgaactt
gcagccaagtcacatcaaaatatggcaaaagcctatgaagaaggcttcttcgatgacttg
atcacacctttcttaggtttagagcgtgacaataacttgcgtccagattctagcgttgaa
aaattggcaaagttaaaacctgcttttggtaaaggcgatgcgcgcaccatgactgcgggc
aactcaactccgttgaccgatggtgcttctgtggtattactggcttcagaagaatgggca
aaagccaatggtcacgaagtactggcttatttaagtttctctgaaactgctgcggtcgac
ttcattggtaagaaagaaggcttgctgatggcaccagcctatgcagtaccgcgtatgcta
gaacgcgcaggtcttaaacttcaagattttgattactatgaaattcatgaagcctttgca
tcacaagtgctttcaacccttaaagcatgggaagatcctaaattctgtaaagagcgttta
ggtttagatgcaccgttaggttcaattgaccgcactaaacttaacgtcaaaggttcatct
ttggctgcaggtcacccatttgctgcaacaggcggtcgtattattgctagcgctgcgaaa
ctgattaaccaaaaaggttcaggtcgtgtactggtatcaatctgcgctgccggcggtcaa
ggtgtaaccgctattattgaaaaataa

DBGET integrated database retrieval system