KEGG   Acinetobacter sp. TGL-Y2: AMD27_12810Help
Entry
AMD27_12810       CDS       T04425                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
acv  Acinetobacter sp. TGL-Y2
Pathway
acv00071  Fatty acid degradation
acv00072  Synthesis and degradation of ketone bodies
acv00280  Valine, leucine and isoleucine degradation
acv00310  Lysine degradation
acv00362  Benzoate degradation
acv00380  Tryptophan metabolism
acv00620  Pyruvate metabolism
acv00630  Glyoxylate and dicarboxylate metabolism
acv00640  Propanoate metabolism
acv00650  Butanoate metabolism
acv00900  Terpenoid backbone biosynthesis
acv01100  Metabolic pathways
acv01110  Biosynthesis of secondary metabolites
acv01120  Microbial metabolism in diverse environments
acv01130  Biosynthesis of antibiotics
acv01200  Carbon metabolism
acv01212  Fatty acid metabolism
acv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:acv00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMD27_12810
   00630 Glyoxylate and dicarboxylate metabolism
    AMD27_12810
   00640 Propanoate metabolism
    AMD27_12810
   00650 Butanoate metabolism
    AMD27_12810
  Lipid metabolism
   00071 Fatty acid degradation
    AMD27_12810
   00072 Synthesis and degradation of ketone bodies
    AMD27_12810
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMD27_12810
   00310 Lysine degradation
    AMD27_12810
   00380 Tryptophan metabolism
    AMD27_12810
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AMD27_12810
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AMD27_12810
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMD27_12810
Enzymes [BR:acv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AMD27_12810
Exosome [BR:acv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMD27_12810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HlyD_D4
Motif
Other DBs
NCBI-ProteinID: AMW79685
UniProt: A0A143G6A5
Position
2694793..2695968
Genome map
AA seq 391 aa AA seqDB search
MTDIVIVNGARTAMGGFQGSLASVTAPQLGSITIKEAIARSGLQASDVEEVIMGCVLPAG
LKQGPARQAMRLAGLPDSTGAVTINKLCGSGMKAVMQAADMIKAGSASIVVAGGMESMTN
APYLLPKARGGFRMGHGEIKDHMFLDGLEDAETGRLMGSFAQDMANTRGYTREQMDDFAI
RSLKRAQNAITEGYFADEIVPVPVSSRKGDVIVDKDEQPFNANIDKIPTLRPAFAKDGTI
TAANASSISDGASALVLTSIENATTKGLKPLAKIVAYASNSQHPSEFTIAPVGAIQKALD
KAGWTASEVDLWEINEAFAMVTMCPIDDFKLDAEKVNIHGGACALGHPVGSTGSRIILTL
IHALKRTGGKRGIAALCIGGGEATAVAIELI
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgactgacatcgtgattgtcaatggtgcccgtactgcaatgggtggttttcaaggtagt
cttgccagtgtgaccgccccacaactcggctctattacgattaaagaagcgattgcacgt
tcgggcttgcaagcatccgatgttgaagaagtgattatgggctgcgtactgcctgcgggt
ttaaagcaaggccctgcacgtcaagccatgcggcttgctggactacctgattcaacaggt
gcggtaaccattaataaactctgtggttctggcatgaaagctgtgatgcaagcggcagat
atgattaaagcaggttctgcaagtattgtggttgctggtggtatggagtccatgaccaat
gctccgtatctattaccaaaagcgcgtggcggtttccgcatgggtcatggtgaaattaaa
gatcacatgttcctagatggtttggaagatgctgaaacaggtcgtttaatgggttcattt
gcccaagatatggcgaatacacgcggctacacacgcgagcaaatggatgatttcgccatt
cgttcattaaaacgtgcacagaacgcaattactgaaggctattttgccgatgaaatcgtg
cctgtacctgtttcaagtcgtaaaggcgatgtgattgttgataaagacgaacagccgttt
aatgccaatatcgataaaattccgacactccgccctgcctttgccaaagacggaaccatt
accgcagccaatgcaagttcaatttcagatggtgcctctgctcttgttttaacgtcaatt
gaaaatgcgacaaccaaaggtttaaagcctttagcgaagattgtagcctacgcatcaaac
tctcaacatccatctgagtttaccattgcgccagtgggcgctattcaaaaagcgctggac
aaagcaggctggacggcttctgaggttgatctttgggaaatcaatgaagcttttgccatg
gtcaccatgtgtccaattgatgatttcaaactcgatgctgaaaaagtcaatattcatggc
ggtgcgtgtgcgctcggtcaccctgttggctctacaggttctcgtattattttaaccttg
atccatgccctaaaacgtacaggtggtaagcgtggtattgcggcgttatgtattggtggt
ggtgaagcaactgctgtagcgattgagttgatctag

DBGET integrated database retrieval system